SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0G4NYD6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0G4NYD6
Domain Number 1 Region: 121-208,264-330
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 2.94e-18
Family SMI1/KNR4-like 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0G4NYD6
Sequence length 520
Comment (tr|A0A0G4NYD6|A0A0G4NYD6_PENCA) Cell wall assembly/cell proliferation-coordinating protein, KNR4 {ECO:0000313|EMBL:CRL19080.1} KW=Complete proteome; Reference proteome OX=1429867 OS=Penicillium camemberti FM 013. GN=PCAMFM013_S002g000950 OC=Eurotiomycetidae; Eurotiales; Aspergillaceae; Penicillium.
Sequence
MTSYDRHASHDSPYRTGRHVPLSQSRHEPLTSIATSAIESRPDLSNPYDDEPIKGSASAQ
ASEWNASPDDLGSPTQPYSPGMRSVASQKRRSNEQGEGAPEIQMQSFHDGAPPPPPVAHS
WRKIERWLESNYEELLDQLGEGCTQNDINELEHELDCSLPLEVRESLMVHDGQERGGQPT
GVIFSAMLLDCEEIVQEWRNWKTVNDEYLSNATTMQNPPAPSSAASSSAAGPSQQPSSTM
WQADLLERQDSQPPGAVQKSYANPAWIPLARDWGGNNLAIDLAPGPAGKWGQVIIFGRDY
DCKYVVARSWAAFLATLADDLCSGHVVVDEQTDELKLKPFKNQNVDPPYLDILRWRTDQK
YGRRAPRRKGPVPNGLGVNASGNRSSSRESPYGSPTRTEERGRSPHRFSKSGNAQSPKTP
FGVSSPLARVTEETTSPAVTVGPTISEDAKENDKEPQTEDLMEVVTPQISNKENEGFPKP
NELKESDKAEKIEKIEKTDSAESSAAIESEVLGEMKNVAI
Download sequence
Identical sequences A0A0G4NYD6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]