SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0G8C0P6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0G8C0P6
Domain Number 1 Region: 1-145
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 6.41e-33
Family SMI1/KNR4-like 0.0000411
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0G8C0P6
Sequence length 149
Comment (tr|A0A0G8C0P6|A0A0G8C0P6_BACCE) Uncharacterized protein {ECO:0000313|EMBL:KKZ93447.1} KW=Complete proteome OX=1396 OS=Bacillus cereus. GN=B4147_2683 OC=Bacillus cereus group.
Sequence
MNKEEITNFIKEYREIDDFTGGVNESQIYAVQYRLSVELPDSYKWFLNTYGSGGLFGVDI
LGVGKSNIASVVIVTEGYRGLEMSDNLVVIEDAGEYAYCLDISHMENNECPIIAWNKQGG
LDDYRTAKNFYEFLSQRLIDAKEVWGEEF
Download sequence
Identical sequences A0A0G8C0P6
WP_046959807.1.89704

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]