SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0H2S742 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0H2S742
Domain Number 1 Region: 163-250
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000000013
Family UAS domain 0.038
Further Details:      
 
Domain Number 2 Region: 363-455,484-496
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000178
Family UBX domain 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0H2S742
Sequence length 546
Comment (tr|A0A0H2S742|A0A0H2S742_9HOMO) Uncharacterized protein {ECO:0000313|EMBL:KLO12666.1} KW=Complete proteome; Reference proteome OX=27342 OS=Schizopora paradoxa. GN=SCHPADRAFT_915548 OC=Agaricomycetes; Hymenochaetales; Schizoporaceae; Schizopora.
Sequence
MYPSIGTELWIGWPALNSDGFLVSQVWSQATFSPLSPSNYVVRLEQALSVDCRMIVAQHY
GLISPTIPEQSAVEWSPWANRLSIGGGGRPGHATDPASVADRWVRQLEEETGAICESRVD
VGGGGGNGATAMTTGAAAGAGPGPSTLSSRRSALSKAAGQRVLPDFYMGSYESALRVAEK
EMRPMMVVLVSEEHDDVADFKRMVLVDEDLVRVLRENDFVVWGGDVRDYEASQASQKLGA
TTYPFVAFVALQPRGGRNSSSSILTVLSRHQGPAVPRSPQLSASSNTSVVPTAASTLVNH
LTNTLLPRVTPHLGRLRGAAAERALAARLIAEQNAAFQASADRDRERIEMAEIAIREREE
EERRRKREEEERKLKEEEEFCRRESEKAERLLWWRYARRCLLAPEPSPSSTDGGKPVRIA
LRLPSGARVVRLFSPSTPITQLYIAAASNLIPQEHAPSDDPKEPPSTYRTIQSVAAVESK
CWNFALATTYPRVVIPGDGKSKIGDIRGLRYGGVVAIEMQDDIPVSPPRSIRGGEDDSDG
YETEED
Download sequence
Identical sequences A0A0H2S742

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]