SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0H2X5D1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0H2X5D1
Domain Number 1 Region: 206-281,312-366
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00000000144
Family SMI1/KNR4-like 0.015
Further Details:      
 
Domain Number 2 Region: 27-74,104-177
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0000000445
Family SMI1/KNR4-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0H2X5D1
Sequence length 373
Comment (tr|A0A0H2X5D1|A0A0H2X5D1_XANC8) Uncharacterized protein {ECO:0000313|EMBL:AAY48205.1} KW=Complete proteome OX=314565 OS=Xanthomonas campestris pv. campestris (strain 8004). GN=XC_1135 OC=Xanthomonadaceae; Xanthomonas.
Sequence
MAGLEWKVYGRAPTLDTFWDEALNLGRSPATDASIAAAQARLGVRLPDWLRHLYARYDGG
AVQMARGQSLQQPDNWLAAEWLIPRARLLGAEALFSFAQVRAREDYRDDAYAGLAASGDD
RWLIAIAADARAPSRALCLDYAAPDTEPTLVYVDAGSGQRLIVFDGVEHLLAQLVDVVCW
SPALQAKYDDNERVHWQPQPPALETFWSGPGHWSDAPTVADTEALAAAEARLGVRLPALF
KRLYGVQDGGDTGWCWAPRTRFPSDRYVDWECVLVDRYLSPLAQIGSVLDFAAAFEDPQD
FSSAAYLHAGLDQVLVLSSHNVDCLLCLDYRGRGPHYAPEVVYFERWEGLHPTWRAPSFE
AFFSTLRQADLDF
Download sequence
Identical sequences A0A0H2X5D1
gi|66767463|ref|YP_242225.1| WP_011269564.1.12496 WP_011269564.1.16446 WP_011269564.1.1732 WP_011269564.1.18295 WP_011269564.1.27778 WP_011269564.1.31612 WP_011269564.1.36111 WP_011269564.1.40219 WP_011269564.1.475 WP_011269564.1.56666 314565.XC_1135

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]