SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0H2XBW5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0H2XBW5
Domain Number - Region: 138-176
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0585
Family Xylanase/endoglucanase 11/12 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0H2XBW5
Sequence length 363
Comment (tr|A0A0H2XBW5|A0A0H2XBW5_XANC8) Uncharacterized protein {ECO:0000313|EMBL:AAY50949.1} KW=Complete proteome OX=314565 OS=Xanthomonas campestris pv. campestris (strain 8004). GN=XC_3909 OC=Xanthomonadaceae; Xanthomonas.
Sequence
MKPSSPLSDPSVTPFLQRSPTLQAGLAQLNRDNIGVVWGTAGAGTYLVPRTQVVIDENAV
GNGARIARSLSHEIGHHRFSEQSDQSSKNGYVTSMLRGEAAATLSNALIRREIINNNGPD
IGISGSGTRPQQYQAIADQQMAGRITRDAALNQIAQVFKTEKPSVGPSKTYEQYYGDYYD
KYIAPLQRKQGRPEPGGVGDISTSDVKQGGLGPESPSVSPKTTLLPSQPGHADHALYQQI
RGGVMQLDAQHGKEWDGASQRMTASLLALAKEEGLSRVDHVALNNPTPQLAGGEKVFVVQ
GALNDPAHQRAHMPTIEAVQTPEIQSFDRLQALNQTQAQAREQQQALEQSQQAVSQAGPS
MTR
Download sequence
Identical sequences A0A0H2XBW5 Q8P4Y1
NP_638913.1.47755 WP_011038659.1.16446 WP_011038659.1.1732 WP_011038659.1.18295 WP_011038659.1.22538 WP_011038659.1.27778 WP_011038659.1.43481 WP_011038659.1.4502 WP_011038659.1.475 WP_011038659.1.82601 gi|66770207|ref|YP_244969.1| 190485.XCC3567 314565.XC_3909 gi|21232996|ref|NP_638913.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]