SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0H2ZXY8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0H2ZXY8
Domain Number 1 Region: 15-195
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 1.26e-44
Family Methylesterase CheB, C-terminal domain 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0H2ZXY8
Sequence length 305
Comment (tr|A0A0H2ZXY8|A0A0H2ZXY8_MYCA1) Protein-glutamate methylesterase {ECO:0000256|SAAS:SAAS00706697} KW=Complete proteome OX=243243 OS=Mycobacterium avium (strain 104). GN=MAV_4066 OC=Mycobacterium; Mycobacterium avium complex (MAC).
Sequence
METERVTTEADRPGVELVALVASAGGLEALTTVLRDLPRDFPAAVVVQQHLAGHDSLLAT
ILTRQSGRPVGWAANGRAVTPGEVVICPPGKALELTPQGRWRLHGAQQHGARGADVLLTS
IAGSYGPRGVAVVLSGSGRDGAAGTVAMRRAGGVVIAESPATALYPSMPIAAAQAGADLV
LGIGEIAPVLADLVHGLPLPRRSPPADAPDEAHLDGGVDPDGIFARLAARFGANTPAARA
ELARLRAAELRRRRQELSAGVGATRETVATAQRRAEESRRRALLAHRAADEAWARSEQEH
RDRDG
Download sequence
Identical sequences A0A0H2ZXY8
243243.MAV_4066 gi|118464684|ref|YP_883217.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]