SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0H3DZ43 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0H3DZ43
Domain Number 1 Region: 27-82,122-172
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 3.79e-17
Family SMI1/KNR4-like 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0H3DZ43
Sequence length 176
Comment (tr|A0A0H3DZ43|A0A0H3DZ43_BACA1) Uncharacterized protein {ECO:0000313|EMBL:ADP32270.1} KW=Complete proteome; Reference proteome OX=720555 OS=Bacillus atrophaeus (strain 1942). GN=BATR1942_06580 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
Sequence
MKTGTIKTVKKVFNSFSIQMGEYNESFNNIKQKLKEFSIDVKTDPSINTNEKLKEIEMNI
GKQLPCDYKDFLKEYGGCDLESKKTTDEVEYDVCYKPFEKDPWMGKDNDTQLLEGFYGLA
NDHNSLQIAIDTYSDRFSKNIIPIASSAGGNEICMDLVNEKILFWDHELSHLGQFV
Download sequence
Identical sequences A0A0H3DZ43
gi|311068278|ref|YP_003973201.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]