SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0H4B5B1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0H4B5B1
Domain Number 1 Region: 80-158
Classification Level Classification E-value
Superfamily ACT-like 6.41e-25
Family IlvH-like 0.0025
Further Details:      
 
Domain Number 2 Region: 1-75
Classification Level Classification E-value
Superfamily ACT-like 1.63e-21
Family IlvH-like 0.00084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0H4B5B1
Sequence length 176
Comment (tr|A0A0H4B5B1|A0A0H4B5B1_SYNPY) Acetolactate synthase {ECO:0000313|EMBL:AKN60101.1} KW=Complete proteome OX=32052 OS=Synechococcus sp. (strain WH8020). GN=WB44_02035 OC=Synechococcus.
Sequence
MKHTLSVLVEDESGALSRIAGLFARRGFNIDSLAVGPAETNGQSRLTMVVEGDEHTLQQM
SKQLDKLVNVLQVLDLSQLPAVERELMLMKVSAPAEQRSAILELVQVFRAKVVDVADDAL
TLEVVGDPGKLVALERLMAPYGILEIARTGKVALERASGVNTELLKAAISGGRVPA
Download sequence
Identical sequences A0A0H4B5B1 Q0IBQ9
gi|113955111|ref|YP_730113.1| 64471.sync_0900 WP_011618839.1.28265 WP_011618839.1.57161

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]