SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0H4X3V0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0H4X3V0
Domain Number - Region: 2-53
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.000196
Family SMI1/KNR4-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0H4X3V0
Sequence length 245
Comment (tr|A0A0H4X3V0|A0A0H4X3V0_9DELT) Uncharacterized protein {ECO:0000313|EMBL:AKQ70356.1} KW=Complete proteome OX=1297742 OS=Myxococcus hansupus. GN=A176_007268 OC=Cystobacterineae; Myxococcaceae; Myxococcus.
Sequence
MEQLISAITRYHPTFRGEIEGYTSEEIEKHQAIVGRPLPGPYVDFLRSMGRRMGELSFQE
GDFRMEALTRYYAHVGASRDSALVIGISRYETGEQPIELDEDEDTGEFVLTAYPPPERPR
EFSESIQIFDLVEPTLHEALFAKAYLKYRWPQFSHQRTLFFAAKSPSEVERGAAQLTPFG
FEQHAESTVVRYFERHDATAIMSPNPGESVRLSLSMRDEVRLQELVEGLSKRLAATPSPP
SREGL
Download sequence
Identical sequences A0A0H4X3V0
WP_002634050.1.53523

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]