SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0H5S6X3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0H5S6X3
Domain Number 1 Region: 105-249
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.71e-34
Family Ankyrin repeat 0.00025
Further Details:      
 
Weak hits

Sequence:  A0A0H5S6X3
Domain Number - Region: 48-120
Classification Level Classification E-value
Superfamily Cytochromes 0.0906
Family Cytochrome c'-like 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0H5S6X3
Sequence length 264
Comment (tr|A0A0H5S6X3|A0A0H5S6X3_BRUMA) Bm3630 {ECO:0000313|EMBL:CRZ24143.1, ECO:0000313|WBParaSite:Bm3630} KW=Complete proteome; Reference proteome OX=6279 OS=Brugia malayi (Filarial nematode worm). GN=Bm3630 OC=Spiruromorpha; Filarioidea; Onchocercidae; Brugia.
Sequence
MVDSENEEPMEIHSSTVTTDYEHNRPGSSMSTATSSTLCQSFEDFDGNNAAEMEDTIPSV
IDFTRQSKLMAKIRDNKRKLPSRWDDDDDDGILAKDMNDPKEQVLTAAEDGNLESLKDLI
ENNPSLLSARDVDGYTALHRAAYSGHTDIVGYLLSIGANPEWNTNDGWTVLHCAATWSMC
EVVALLLRHGVDVNSRSHGNLTPLHLAITSNQSEDRVLTTVRYLLEAPGIDAAAVSNSGD
SPLRVAERTSAKITEMLMRYFSKP
Download sequence
Identical sequences A0A0H5S6X3
Bm1_30650 XP_001897569.1.25112 Bm3630

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]