SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0I9N581 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0I9N581
Domain Number 1 Region: 3202-3308
Classification Level Classification E-value
Superfamily Cadherin-like 1.07e-28
Family Cadherin 0.00068
Further Details:      
 
Domain Number 2 Region: 1028-1162
Classification Level Classification E-value
Superfamily Cadherin-like 2.14e-25
Family Cadherin 0.0007
Further Details:      
 
Domain Number 3 Region: 2690-2813
Classification Level Classification E-value
Superfamily Cadherin-like 5.57e-25
Family Cadherin 0.001
Further Details:      
 
Domain Number 4 Region: 3721-3934
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.03e-25
Family Laminin G-like module 0.0057
Further Details:      
 
Domain Number 5 Region: 720-818
Classification Level Classification E-value
Superfamily Cadherin-like 1.06e-23
Family Cadherin 0.0012
Further Details:      
 
Domain Number 6 Region: 1967-2076
Classification Level Classification E-value
Superfamily Cadherin-like 7.99e-22
Family Cadherin 0.0015
Further Details:      
 
Domain Number 7 Region: 813-932
Classification Level Classification E-value
Superfamily Cadherin-like 4.85e-21
Family Cadherin 0.0029
Further Details:      
 
Domain Number 8 Region: 1654-1773
Classification Level Classification E-value
Superfamily Cadherin-like 2.57e-20
Family Cadherin 0.0014
Further Details:      
 
Domain Number 9 Region: 3103-3207
Classification Level Classification E-value
Superfamily Cadherin-like 8.85e-20
Family Cadherin 0.0015
Further Details:      
 
Domain Number 10 Region: 2177-2275
Classification Level Classification E-value
Superfamily Cadherin-like 1.16e-18
Family Cadherin 0.0012
Further Details:      
 
Domain Number 11 Region: 928-1043
Classification Level Classification E-value
Superfamily Cadherin-like 1.23e-18
Family Cadherin 0.0029
Further Details:      
 
Domain Number 12 Region: 1139-1236
Classification Level Classification E-value
Superfamily Cadherin-like 1.86e-18
Family Cadherin 0.0014
Further Details:      
 
Domain Number 13 Region: 2075-2182
Classification Level Classification E-value
Superfamily Cadherin-like 7e-17
Family Cadherin 0.0019
Further Details:      
 
Domain Number 14 Region: 1453-1584
Classification Level Classification E-value
Superfamily Cadherin-like 2.59e-16
Family Cadherin 0.0049
Further Details:      
 
Domain Number 15 Region: 2482-2587
Classification Level Classification E-value
Superfamily Cadherin-like 2.86e-16
Family Cadherin 0.0038
Further Details:      
 
Domain Number 16 Region: 2389-2493
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000113
Family Cadherin 0.0071
Further Details:      
 
Domain Number 17 Region: 139-227
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000006
Family Cadherin 0.0022
Further Details:      
 
Domain Number 18 Region: 3304-3420
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000642
Family Cadherin 0.0028
Further Details:      
 
Domain Number 19 Region: 3000-3110
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000728
Family Cadherin 0.0017
Further Details:      
 
Domain Number 20 Region: 478-596
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000143
Family Cadherin 0.0078
Further Details:      
 
Domain Number 21 Region: 1766-1862
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000228
Family Cadherin 0.0022
Further Details:      
 
Domain Number 22 Region: 390-482
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000443
Family Cadherin 0.0076
Further Details:      
 
Domain Number 23 Region: 2593-2695
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000585
Family Cadherin 0.0073
Further Details:      
 
Domain Number 24 Region: 1876-1979
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000443
Family Cadherin 0.0015
Further Details:      
 
Domain Number 25 Region: 609-713
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000186
Family Cadherin 0.0063
Further Details:      
 
Domain Number 26 Region: 2794-2923
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000443
Family Cadherin 0.0083
Further Details:      
 
Domain Number 27 Region: 3939-3980
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000028
Family EGF-type module 0.0085
Further Details:      
 
Domain Number 28 Region: 2277-2380
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000013
Family Cadherin 0.0045
Further Details:      
 
Domain Number 29 Region: 3972-4012
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000851
Family EGF-type module 0.018
Further Details:      
 
Domain Number 30 Region: 4015-4056
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000114
Family EGF-type module 0.021
Further Details:      
 
Domain Number 31 Region: 1262-1336
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000485
Family Cadherin 0.0075
Further Details:      
 
Domain Number 32 Region: 3416-3519
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000614
Family Cadherin 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0I9N581
Sequence length 4464
Comment (tr|A0A0I9N581|A0A0I9N581_BRUMA) Bm3576, isoform a {ECO:0000313|EMBL:CTP81224.1} OX=6279 OS=Brugia malayi (Filarial nematode worm). GN=Bm3576 OC=Spiruromorpha; Filarioidea; Onchocercidae; Brugia.
Sequence
MASRRLLLLAPLLFSLVGSSWNYRRKIDTFQFTAPVYNVSLEENARGKDIYAIVNEPIRM
GVPLPSDDAVLKFRIVEGDRQYFKAEVKTVGDFAFLLIRYRNDGILNRELKDRYEFLIKA
SCRRKDATNLETTVMVNLFVRDQNDAGPIFEKDEYRTEVKQNVSPFTTILQVQASDADVA
LNSQIYYSLVEWSLDFMVDPISGAIRNLRLLESGTYELIVLAEDRASRLFRKKAHSDNGN
NLFNHNKAKAVLFSLISKFSTLSGPTTVITVEPVERNKRKLSVEVKPISVSLWNVTQTVA
IARIEGVAADVVTTLEIVDGEYAGAFVLKKDSSSANVWLVETISGIWPQADWFIQLKATA
VDDFVENLMENISVQLKGKRLVQYDDNLEVMQIVVNESVPLGYVLTQLKAHVVNGIDGDN
EQIRYSISNTDKPFSVDENNGYLRVIKWLDYENVSSYRFEVSAKLLDSTLEAKKAVEVIV
ADSNDHCPTFAVKWTRGDPIALSRNYPINKVLFKAEALDIDSGANGRIRYELIGETVTIM
RIFTVIPDSGEVVLQQKPPDNESQWKLRIRASDAGWPFPRSSEVLISIYISGTNPPPKTK
PSFLRKPQNDHSPVFMKQTVFVVSADTPPGKVVGRIESHDDDMGYAGLIRFGTFDKFFAL
EPFTGEVVLLAPLGELLRNKNKKKQMEYIVEIIACDWGQPVRCTNGTVTFLITEANVYRP
HFEKPYYRVHIAEDTTIGTKFLAVLAQDNDYGDNGQVGYQIIDSQNHFQIDENTGVLQVM
TKLDREEVAFHRLTIMAFDHGHPMKVTFVNVTVVLTDINDNAPLCVEPIRKIIIPEDYPN
NALLTCVAAWDPDEGKNGKVAYTFDTIIETSLTLPFRIQEDTGCIFVNTDEPFDFETINR
YNLSVEAMDNGEPMLSSICTVLVEFSDVNENLFPPLFDDIAREATVYENVPLWTEVFALK
AVDPDSPEMPVKYTVIDGDGISSFIIDSEGILRTSIVLDREACDSYWLTIEACDMNPVPL
CSVLHVFVRVLDINDHIPLSIHPIYFSTIPENSPEDTVITKVEAEDKDDLSDRHDITNIR
FKIVSGDPQSFFAIDSKTGYIVTRGKRRLDRETQKEHVIVVEICDQGHPKLCTTVSVVIT
ITDLNDNLPLFKQTTYNFNVPADKIGELCRVFAMDIDEGQNARILYNFTEADPRFSIDSD
GQIITTDSLKENENYQLTIKASDMGQPLQTSSPVLVTLNAVRRHTKKTVNGKPKLLNENR
WSRLSISDADSIGETIGLIEAEDPDGDQLWWKITDGNPNNTFAISCDAGELYLAKSLDLI
KKNITIVKLKFTVDDGLDTTEGVVLIEISRKYRPEFDAHYHKILVPKTAPIGTVVHTLKA
TIEKLNDSISDRGIIFGIHVVEDIAVTDILLINPSSGEVVIAEPLNNIVTNFFIIVVYAR
FNQMINYAQLGISLFDETKTPPKFVVSEYFTTISTSLPVGTPVLTVRAYDSDHSSIQYSI
IEGNEDGHFAINEYSGEIRTSQLISYNHERTTLIVQASIQKNSSLTDRCSVRINILNDDL
GRVNFPQPSYSLTVHESTPPNTIVYILKTNSVMSIRYSFRDPCPFLSVHPISGVISIKLV
TSAASVPHTCIAIARNSLGTEDFMELKINVVSENQYAPYFSSTVYQGYIYENMPLNSSVL
LEDGRQLLVKAIDHDRGINGLVTYCIVSPLEPYFTIDYISGAILTKREIDFEKVKHWSFY
VQASDSAPQVLTSPVPALVEIMVFDMNDEPPSFIQEYYNATLFLPTLKNTTVCYVTAIDV
DTVGILRYAIIASDDSQLFAIEEFTGRIYTSGNSSADYAKSDYEINLVVSDGLKSDSTVL
LVRTENTSETGSTIKFLATNYEAVITENMTSSIMVQLLTVCAISTVNGSLLYSILNPSSY
FIVGVTSGIISWTGTAIDREKMPVVKLIVQARLSNGANERAQSIVTIKVEDKNDCEPRFI
GLPYELTIPRDIKLADKVTNVKAVDADEGFNGAVRYKLKTSTEYFDINEYDGKIVISRSL
EIANFDSVSLEVIAEDQGEPSLSSSAHVVIHIVDRNIPIFGNRYQEAHILESAAPGSLVT
NVHAASIVGGRIGYAIKSGNDENRFRIDFDTGMINVHKPLDREKCTFYNLTVVAIDVTRQ
GVRAESYVVVNVDDISDTPPHFTQFFYSISVSESAAIGTQLLQIEAIDPDINDNHISYGI
TGPNASVLSVDPRSGVISLMKSLDFETMRLFKFKLTASDSMQLTSETDLLLHVTDANDVA
PRFISKTFNSVVESETPINHFITKLDASDEDIMSNLGDGNRFLFSIIDGDVTLLQINQST
GVVSLLRAVAEDDLNIGKKHFNVSVSDGIFTDFCLLIVKIVRSPSEHQLPRFERMHYSAA
VQENGPIGMTVMTVQAYNGIPPLRYSFNGCHENCSGILNIDETTGKVYTRNLFDYEAQRI
HQFVIMVTDAGDRCAFATLTLSVIDENDNIPQFISSKVEISVPVDSRPGESVLMVFAFDY
DVDDELEYSIVDSDEIRSKYFTIHPKQGLISVKELLNDLVGEQISLFVRVTDSADPPHQN
ETSVILNVSPIVHLPKFSTQHFLFSVSEDVPIGTVVGRLQQDSQLELSDVFFSLVSMDNL
SDFPFSVKQESGQIVVNSVLDYEKTREIRFLVSLHSQRQLNAKAVSLVTVRITDVNDNKP
RFEITSERVVISEDLPIGSSITIIRAVDEDAVGLNSKVQYFLEEGNNSSTFKLDQETGWL
SLFKEVDREVIEEYALIVNARDGGGQSTRKKITVVLKDVNDSPPQFSQETYFIEQYMEDL
RVGQDILQLQVHDPDLYPNNVTSLYIMRGNEHGIFGLEMNSLVLHKLPTDSDSLESHLLI
LAHDGKYTATAEVVVKLLSNFSQFQCEPREILRNITEDSPTGTIIKMGYQKVRKSLRFYL
TGSESNLFAVENSGTVVVRDQLSSHISNQVELFLRAESPESLCIQRIIVKIERTSKGRVT
FTQPVFYGMVRENRNATKEEKVFATRLETTIDDLDGIGSVTFKFANNSNQYLDLFDIDSE
TGVIAAISSLDREIKDQYDFSVLAVSTAGNSAEAKVIIDVGDVNDNAPVFEQNIYHLRIA
EDEALGKELLQLKAYGGDDKEIISYQMQASDDVAKYLSIDANSGLLKLASVLDFEKLEKF
MVSVIATDSGKPPLNSTCEIDVEILDVNDNPPLFMQHIYRAMVLENMQRGTKVVQVLAND
PDSEHFGRVSYSITNDAVGFTIEEDGWITTTEMLDREVKSTYRLIVKAVDGGTPPLSDST
IVEIEVEDENDNAPVFKHCNMTAVVQESVEPGHVILPIFITDNDKEPNTGPYRLEIIGDG
ASLFAFDRNLNLITTKRLPPHAKKEVYLLSVKVSDRDNLSTECPMTLFVKEESRHAPQSN
PLKITLNTLMGEFLGGIVGKIMATDEDSTDMLRYSLADREASANTIWSNHQHSKIPFSID
SETGDIIGEADLLAGTYRFNVSVTDGKYIAVVPVVIDVISIDQDALDHSVSVRIHNLLGE
TFFNKHVKNFMHSLSRFLNVKPQNVRILSVQSTLVRHHLLARQLNNKTTSEQDLDILFTV
SRADSRGYHRPNFIRQRLEDNVAQLSDDIGREIISIITEMCRRDVCANGECRDRLYLDDT
HNVCYKTDRQSFSAPVHLRTYDCTCRTGYAGKRCDIPVDKCSRDQCTKEEICVPMNTDIG
FDCICPPGTTGDRCDATVCGRDRRECSQGAEIGVGGDGFFQITVANSVERRLELTIYFRT
TSADAVIMYGAGNSDFHTIEVERRYVQYRWNCGTGPGVVRINQQTVSDGKWHSLKVSRRS
RHAKLVLDGLYEKEGDSPQGSDVVNLYRQDIRLTFGAMVTQSVDDSTFTTANDLKPIVTK
GMIGCFGRISVDGYEVSKTKQSLYLYNTRLNCNAIVSAPCAANPCKNEGTCIPSSEKAYE
CACPPRYSGSNCEIDLTSCVSRPCPRGVECINLHNDFYCSCPHGFTGKTCQLRGDWDPCL
SNPCGHFGSCIRLPHSATFICNCSHGYSGTACKDRITDLIADGWPLNAIKIAGLIIVILL
LIIFATLIICIYLRIKKSRKSPKVREMEYETNNYNPRVSMSYEGVSHAGVTPAPPLFPRL
HNSNYEKGLPTVQVRPLPIHERISSSSIGGASRSPSLAGSNRCRIRWIAESGSIRNCGSE
RCIVSCDEIEPLASNETLRRYGEVIMGDDDEMASCSSSQLQLSVADRCRRSSGPRYKTGM
KRTRYIRASNEAQTKEDWRKQCEKRINEACDAAAELRGERLKSSAGINKNVTNDCSLNIK
DDDDYMTMQPVHRRVIIQSSESQRRPLLETSDSDGMESADFSYPDEVKPSQHRKPPPPPA
HNIKRKNSKAIVSSSDVPNRVYDEPAIDVGDKKSSKIVKKTQSTSELAHSLERFEDFGNI
DDSDDDRTVNTSTSSNVHQTMAVL
Download sequence
Identical sequences A0A0I9N581
Bm3576a

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]