SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0I9N5P6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0I9N5P6
Domain Number 1 Region: 32-102
Classification Level Classification E-value
Superfamily DEATH domain 0.0000000000000565
Family Caspase recruitment domain, CARD 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0I9N5P6
Sequence length 113
Comment (tr|A0A0I9N5P6|A0A0I9N5P6_BRUMA) Bm7324 {ECO:0000313|EMBL:CTP81369.1, ECO:0000313|WBParaSite:Bm7324} KW=Complete proteome; Reference proteome OX=6279 OS=Brugia malayi (Filarial nematode worm). GN=Bm7324 OC=Spiruromorpha; Filarioidea; Onchocercidae; Brugia.
Sequence
MSADSQTLPCSRPLADSRIEQSYHLDQLRSKLARLDMRDLVPQLVARQVLRSQEMSAVYS
EEKREDQVDKLIEILKTKNHWLGPLIDALIRNGQATLAKELLAINNTKTNKST
Download sequence
Identical sequences A0A0I9N5P6 A0A0R3R916
XP_001894927.1.25112 Bm1_17350 Bm7324

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]