SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0J5R0C5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0J5R0C5
Domain Number 1 Region: 7-154
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 6.67e-19
Family SMI1/KNR4-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0J5R0C5
Sequence length 156
Comment (tr|A0A0J5R0C5|A0A0J5R0C5_9BACI) Uncharacterized protein {ECO:0000313|EMBL:KMK76131.1} KW=Complete proteome; Reference proteome OX=79884 OS=Bacillus pseudalcaliphilus. GN=AB990_12970 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
Sequence
MRMDDRELMKVWKERSAYEPGQIVTDDKIDHIEKAIGFRLPHIYKQLMKLQNGGEMVIPI
YPDDELPFVIQYLQELELDKGVGLSTIFVEELHLPKDLVLITGDMYNWLALDYRVEFKEE
PSVVFLYEGEDSNWKEILVAETFEELITDLLLEIKS
Download sequence
Identical sequences A0A0J5R0C5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]