SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0J9QWH8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0J9QWH8
Domain Number 1 Region: 329-479
Classification Level Classification E-value
Superfamily TRAF domain-like 5.23e-41
Family MATH domain 0.000018
Further Details:      
 
Domain Number 2 Region: 103-167
Classification Level Classification E-value
Superfamily TRAF domain-like 0.000000000258
Family SIAH, seven in absentia homolog 0.038
Further Details:      
 
Domain Number 3 Region: 253-296
Classification Level Classification E-value
Superfamily TRAF domain-like 0.000000719
Family SIAH, seven in absentia homolog 0.011
Further Details:      
 
Domain Number 4 Region: 217-268
Classification Level Classification E-value
Superfamily TRAF domain-like 0.00000915
Family SIAH, seven in absentia homolog 0.019
Further Details:      
 
Weak hits

Sequence:  A0A0J9QWH8
Domain Number - Region: 163-216
Classification Level Classification E-value
Superfamily TRAF domain-like 0.00262
Family SIAH, seven in absentia homolog 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0J9QWH8
Sequence length 486
Comment (tr|A0A0J9QWH8|A0A0J9QWH8_DROSI) Uncharacterized protein, isoform C {ECO:0000313|EMBL:KMY88049.1} OX=7240 OS=Drosophila simulans (Fruit fly). GN=Dsimw501_GD23279 OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MVRSLAQWTKTLSFPSRLSPNRNSKDCSTLASPVPPPTPPRNKTTSGSGNCATSRSSSST
VSSSHSSSHSSPTPGNNNNNMPITELEQIIYPGPDPKHIMGSLVFCIHHKQGCKWSDELR
KLKGHLNACKHDATQCPNKCGAQIPRIMMTDHLQYTCTMRRTRCEFCQSEFSGAGLEEHN
GSCGQEPVYCEAKCGQRILRGRMTLHKSKDCAKRLRRCAHCQREFSADTLPLHAAQCPRA
PLACPQRCDAGPIPRGELEAHLRDECQSLAVSCSFKEAGCRFKGPRQMLEAHLESNAAAH
LSLMVALSSRQGQQIQMLKSAVSKLSINYTGTLLWKITDWSAKMAEARGKDGLELVSPPF
YTSQYGYKLQASMFLNGNGPGENTHVSVYIKVLPGEYDALLKWPFSHSITFTLFEQGAQS
GQGGVAESFVPDPTWENFQRPSNEPDQLGFGFPRFISHELLHSRPFIKGDTVFLRVKVDP
SKIVAV
Download sequence
Identical sequences A0A0J9QWH8 Q9XYR0
FBpp0077119 FBpp0077119 NP_477416.1.81976 XP_016023411.1.80810

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]