SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0J9U3K9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0J9U3K9
Domain Number 1 Region: 6-65
Classification Level Classification E-value
Superfamily Duffy binding domain-like 0.00000288
Family Duffy binding domain 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0J9U3K9
Sequence length 133
Comment (tr|A0A0J9U3K9|A0A0J9U3K9_PLAVI) Uncharacterized protein {ECO:0000313|EMBL:KNA01738.1} KW=Complete proteome OX=1035514 OS=Plasmodium vivax North Korean. GN=PVNG_06323 OC=Plasmodiidae; Plasmodium; Plasmodium (Plasmodium).
Sequence
MELANSSYEKCKEYEKYIKEKSPFYEKFDELYIREYKDKNEEFYKKCKSYNPESVLPTLK
CEQKFPEQAKAKGFSHGPGLLESIPSSGKNSDSTNTYGNVLLGVVVTSMTSGMLYKEDGF
ATVMDGIIMLQVT
Download sequence
Identical sequences A0A0J9U3K9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]