SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0J9VC38 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0J9VC38
Domain Number 1 Region: 112-250
Classification Level Classification E-value
Superfamily MTH1598-like 1.16e-44
Family MTH1598-like 0.00041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0J9VC38
Sequence length 250
Comment (tr|A0A0J9VC38|A0A0J9VC38_PLAVI) Uncharacterized protein {ECO:0000313|EMBL:KMZ83748.1} KW=Complete proteome OX=1033975 OS=Plasmodium vivax Brazil I. GN=PVBG_00828 OC=Plasmodiidae; Plasmodium; Plasmodium (Plasmodium).
Sequence
MKQPSSNEIVSLPQRGRRRVGRDSASSDGVESEDNGEQSGYDSAEEAGDSGKSGSSVHIE
GSYKSGSSIHIEGSYKSGSSVHIDCSDEASAQNVALPYAKKKIKDGRLEKTYHYEYLDHP
ADVILHSYGKTLRECFESACVSMFNYMCNLNKVETKISRHITARGGTLEDLLYNFLTECH
FLYGSEYIICKAVDILVFDQGSFFIEASAYGDVFSPDLHECGTEIKAITKHELRICFTED
LWEAFVLVDI
Download sequence
Identical sequences A0A0J9S785 A0A0J9T689 A0A0J9VC38 A0A1G4HIY3 A5K0W1
XP_001616685.1.43797 gb|PVX_085095 5855.PVX_085095 gi|156101984|ref|XP_001616685.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]