SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0K0DMK4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0K0DMK4
Domain Number 1 Region: 255-375
Classification Level Classification E-value
Superfamily PapD-like 6.02e-25
Family MSP-like 0.001
Further Details:      
 
Domain Number 2 Region: 2-173
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 2.09e-20
Family CRAL/TRIO domain 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0K0DMK4
Sequence length 464
Comment (tr|A0A0K0DMK4|A0A0K0DMK4_ANGCA) Major sperm protein {ECO:0000256|RuleBase:RU003425} KW=Complete proteome; Reference proteome OX=6313 OS=Angiostrongylus cantonensis (Rat lungworm). GN= OC=Strongylida; Metastrongyloidea; Angiostrongylidae; Angiostrongylus.
Sequence
MKPLLDRQLAYLHGRDLSDCSILWINLAQYRPNDTGFENVFVFWLEHHTMETKGDPLTIV
LNMTGTSLKNMDFKIFKFIFHALKYYYPSIVHDIIIFESPSMLSASWKKSSSENAPKDSV
KVVKSWLDPSHPQLHHVTKETMSQFVDSRNVPLHMGGEDHFKFTMDDLAKCLPASREDNG
QMTTSATEYSFDRNGLDSMIKRAVTFDDDDEEANRKVPLTISRKSSNGSVKRNIPQCLKP
VIDARLHSPDTNWVKNAFLKISPRDVLDLSRIDNITDYVDIVVVRNISDVSVMFKIKTTS
PEKFRVRPTMGVIPPESTEIIRVYLQSEYKDSCAREKFLLLALESENNNLETFGELWKNA
SSDKKVEQKLRCRVNDACSGEGHKSDQADKKTDPSSQRAQFILVVAMFVLFLTLMVIVVN
ERSRYSALEEAVSMFSKKLNTTECEKAPTTQQQRSPPVTYEEDL
Download sequence
Identical sequences A0A0K0DMK4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]