SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0K0DVQ8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0K0DVQ8
Domain Number 1 Region: 250-379
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000895
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 2 Region: 378-498
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000001
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 3 Region: 166-213
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000829
Family EGF-type module 0.012
Further Details:      
 
Domain Number 4 Region: 204-252
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000034
Family EGF-type module 0.015
Further Details:      
 
Domain Number 5 Region: 129-170
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000378
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0K0DVQ8
Sequence length 1597
Comment (tr|A0A0K0DVQ8|A0A0K0DVQ8_STRER) Uncharacterized protein {ECO:0000313|WBParaSite:SSTP_0000132400.3} KW=Complete proteome; Reference proteome OX=6248 OS=Strongyloides stercoralis (Threadworm). GN= OC=Panagrolaimomorpha; Strongyloidoidea; Strongyloididae; Strongyloides.
Sequence
MKLLLLHLFDLIKSLFFLFFILISICPIYGEVEINVEVDQLRIGDENVCPFEETEIVTVK
EPCVKTYTKYIRRRKPNCNGPKSSCIIKEPKTVYYQTFKKVNRTRRHTVVRCCDGMIQKP
GFPGCVKADCSPDLCHNGGTCLKNIGIDGKICECMDGFTGVYCQYDVNECLAEGRGCQHE
CVNTIGGFYCRCHYGYQLSTDNKTCIDINECEVENGGCEGYCVNLKGNYRCECPGDKKLA
GDGRRCVENNSCSIDNGGCSQICEEKDNQFYRCRCRQGYTLSENKRHCYPIDPCKYNKSG
CQHHCVNHNGQARCQCYPGFRLDRDLKSCIDIDECSDFKNGGCEQICVNVYGTYTCKCHK
GYKLMDDGRSCQVKESGCLIGNGGCQHECYDQMDGEIICGCRDGYELQKDGKSCKDINEC
SKDNGGCDQICKNTMGSFKCECNEGYHLDKDSTNCYDINECLIDNGNCSQICKNTEGGYF
CDCIGGYTLGEDGKTCYVRNNSPRILAISSNSLQNNLLSPLRTNVPDYYYDDENFYKLLD
KDNKYFDGVRNYEIHPMKMGKLRSLNRKIVNKVFKKGHFGPNNEFTCDDCQNGALCRNDL
PNPSCECLPGFEDILCNATCASGTYGFGCAFSCDCGGGPCHHITGECEYINDECKSGFYG
PQCNLTCRMACPNNECDKIFGDCICPAGYYSEKCDKTCTSFTYGKNCRHTCKCSKIGTET
CDIRNGKCKCKMGYYGKNCENECPIGSYGYGCLGKCNCKHGCDKETGKCLKKCPPGKHGV
NCEESCPDGKFGLDCTNKCNCKNGALCNPIDGSCECQPGFYSASCSEPCPISRWGKDCMN
ICNCQNGGKCDPSTGECTCPSGYTGDTCSVPCPRGYYGDDCAKECDCGIKKGFFSSLFGS
FDNDCDIYDGSCICAPGFKSKKGCSELCDEGTFGAGCRGICNCNNNGKCNPKNGVCECNP
GWRGKNCNKPCIDGFFGVKCQERCNCGSDEDFDSEIVMLSKCHHVTGQCQCPPGFLLPDC
RTPCPPNRWGSGCKEKCQCVNGNCDRLTGACTCFSGFMGKYCDKKCPSLMYGPNCQNHCL
CLNNSTCNSVTGECECGEGTTGSSCEFTCPFGTYSKNCEKTCDCMNGAPCDPKTGQCLCL
DGWTGERCDSVCDKNTFGKNCSQVCTCVHGDCDPISGHCTCKPGWRGKNCHKPCLNGYYG
KHCSQPCRCPGQNSCDHITGSCNSCSKGYTGEGCNQLCEPNYYGENCSTKCECGPNAECD
RITGACYCRAGFMGTNCTQGCVPQINFGIDCQGICKCENQGSCNPIDGSCTCLPGFYGAR
CEFKCPDDRWGEDCKNICDCENGTCNKITGNCQCEPGFHGVRCDIPCTDNKYGIGCKEKC
QCLNHGKCNRETGSCKCLPGFYGKYCQEVCPKGKYGIDCSFDCECHGTDNTCDAVSGCCM
CSNGKYGNRCQFTCPEGMFGWQCSQFCDCKMGQCDPINGQCHCDIGWSGENCDKKCDNNT
YGPNCRLTCDCGDFGCNHVTGECLCPPGKTGKQCSEDCEHGTYGENCKNNCKCFNGAKCN
KKTGKCTCATGFLGPNCQDEYIDTESVASRGDLPERF
Download sequence
Identical sequences A0A0K0DVQ8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]