SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0K0J909 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0K0J909
Domain Number 1 Region: 1199-1438
Classification Level Classification E-value
Superfamily Ankyrin repeat 6.02e-56
Family Ankyrin repeat 0.0000115
Further Details:      
 
Domain Number 2 Region: 517-560
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000067
Family EGF-type module 0.0081
Further Details:      
 
Domain Number 3 Region: 672-714
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000276
Family EGF-type module 0.004
Further Details:      
 
Domain Number 4 Region: 261-396
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000612
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 5 Region: 749-790
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000129
Family EGF-type module 0.0034
Further Details:      
 
Domain Number 6 Region: 633-671
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000927
Family EGF-type module 0.0046
Further Details:      
 
Domain Number 7 Region: 710-752
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000102
Family EGF-type module 0.0045
Further Details:      
 
Domain Number 8 Region: 196-239
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000117
Family EGF-type module 0.01
Further Details:      
 
Domain Number 9 Region: 391-428
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000192
Family EGF-type module 0.0061
Further Details:      
 
Domain Number 10 Region: 80-122
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000586
Family EGF-type module 0.0095
Further Details:      
 
Domain Number 11 Region: 116-154
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000682
Family EGF-type module 0.0047
Further Details:      
 
Domain Number 12 Region: 555-597
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000837
Family EGF-type module 0.0086
Further Details:      
 
Domain Number 13 Region: 157-200
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000105
Family EGF-type module 0.011
Further Details:      
 
Domain Number 14 Region: 592-637
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000309
Family EGF-type module 0.012
Further Details:      
 
Domain Number 15 Region: 43-79
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000962
Family EGF-type module 0.0073
Further Details:      
 
Domain Number 16 Region: 844-874
Classification Level Classification E-value
Superfamily Notch domain 0.0000017
Family Notch domain 0.0059
Further Details:      
 
Domain Number 17 Region: 881-912
Classification Level Classification E-value
Superfamily Notch domain 0.00000575
Family Notch domain 0.0029
Further Details:      
 
Domain Number 18 Region: 444-486
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000109
Family EGF-type module 0.036
Further Details:      
 
Domain Number 19 Region: 477-521
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000112
Family EGF-type module 0.029
Further Details:      
 
Domain Number 20 Region: 802-834
Classification Level Classification E-value
Superfamily Notch domain 0.0000127
Family Notch domain 0.0016
Further Details:      
 
Domain Number 21 Region: 9-40
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000676
Family EGF-type module 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0K0J909
Sequence length 1635
Comment (tr|A0A0K0J909|A0A0K0J909_BRUMA) Bm3148, isoform b {ECO:0000313|EMBL:CDP94070.1} KW=Complete proteome; Reference proteome OX=6279 OS=Brugia malayi (Filarial nematode worm). GN=Bm3148 OC=Spiruromorpha; Filarioidea; Onchocercidae; Brugia.
Sequence
MGDRCEERCDCLNGGECLRRGSLSICVCPIGFNGTLCEYRQPSRCDEAPCVHGRCILSKS
LDTFRCECQIGFTGERCDRRNYCEGNPCRNGGSCISTTGGYRCGCPEGFHGNKCELDINE
CHLNPCVRGKCINEFGSYRCDCPHDFTGRNCETLLFNIDPCSTSPCHNNAKCYTYRDKYY
SCECRPGFTGRHCEVNIDDCSENACMNGGTCIDREQGYECKCPPFYTGRFCEEDIDECEL
GLHECKNGATCFNKKEGYQCVCVNGWEGIHCEINKDDCKDALCEAGSTCVDHLAKYTCEC
PPGRIGLLCHMEDPCLSNPCQVGSVCEPDTSSGKYTCECPKGYTGEDCSNDINECNQDHA
VCYNGGTCVNTPGSFHCECPPGYTDWHCQTHVNQCSTNPCLNSGTCLDYGTRFKCVCMSG
FHGKRCELHCPSGYEGENCERRQYIECSITDCLNGGVCSKGSCRCPPGFTGDRCEKKLDP
CKYHNCPQNAICIPINNSVTYKCECKLGFYGHDCKLEMNECASNPCQHGGVCTDHLNGYV
CSCSAGYTGEQCQTNIDDCIHHPCLHGGTCIDGINSYSCHCALPYDGDRCQYELDPCRTN
RCENGAICKPTPTYRNYTCSCTNGFYGYYCDTDIDECAVNNPCLNGGTCANKFGSYHCRC
SDGYTGRNCESDRDDCLPNPCLNGGHCMDELNGYHCECLAGFTGRQCATNINECESSPCE
NGASCIDHINGFECVCRRGFSGTFCQTNDDDCQPGLCLNGGTCVDGVNSYRCRCQRGFTG
KNCQHQIDLEQFNVTDLLEHELCAKHDCITKAGNKVCDQVCNYYACHYDSGDCSAGTKPF
EKCESPSYCAHVFRDGKCDPICNNQECLFDGFDCDSIPEQCSKNDYCTTHYADGQCDREC
NVIGCGWDGGDCDSFDVETPLEGNIIVILLISPDEFLHNAQTFLFTLSQKLRGAVHIRTI
NGKPMIYSWSSEGGIGQLYDVAPEKRYLLVPNLQRVKRQTDQLRGTMVMLTVDVSYCRKI
DREECFSDLFSIVDYLGAANAKQELQELGMPVHSARVELDNAKQAKGISWQTLLICLLIF
VTTVLIAYSMVQQGRKRKTLHARIWHPPPSESCKSSTGNLDTYSIHSGYLFSNYGTAKRS
RADNIPVGIAHPNLYIGEDTQSFLKPKTLSTDERQWTHLHEAADSTIPISLPIEPLLVNV
RGKHGRTPMMQTASNQAKNEEASCEDIRNLLEAGAEIDAQDDSEDTALMLAVKSGRTTVV
DCLLKNGADPTIVDEKDRTPLHHAVAVNIPNIVQLLLDTRQVNVDALDEDNRTPLIICSK
FDIRMGTEIAEMLLKAKADVACAGDKSLTKYDGRTALHFASQHANLDIIRLLIHNGANKD
AQDSLDQTPLFLAASEGHLDAVECLISLGASKEITDQKERSPRDIAAEKEFRDIVHYLDT
VPTPRILPSNMAATLALSTHQRFKKSFKKTTRPVIKKNPSPTYPSAVTALTAQPATSVNP
LTPPNSDGSNYSTTPSPHDTTAVVHGGTAATRGTTVAQATAGHPENAVLQSSSVMLSPYS
DHHNGTGCSPPQMMTAMQAGWLFPANQSSHQQYEEGLFYGTGMLPFVYDQRTLRPSYSQS
HMPHVQQPSTAYYNV
Download sequence
Identical sequences A0A0K0J909
Bm3148b

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]