SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0K0JCJ1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0K0JCJ1
Domain Number 1 Region: 7-49
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.000000366
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.003
Further Details:      
 
Domain Number 2 Region: 156-203
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000101
Family Motor proteins 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0K0JCJ1
Sequence length 222
Comment (tr|A0A0K0JCJ1|A0A0K0JCJ1_BRUMA) Bm3950 {ECO:0000313|EMBL:CRZ21686.1, ECO:0000313|WBParaSite:Bm3950} KW=Complete proteome; Reference proteome OX=6279 OS=Brugia malayi (Filarial nematode worm). GN=Bm3950 OC=Spiruromorpha; Filarioidea; Onchocercidae; Brugia.
Sequence
MAESSNENYKVPIGLRPLLEAFVRETLRTQPIDLVSFSILSFNVLQKHRKQNNAEDVFKD
SALYESFKIDLQKQYHEKDEMTERSLEPLEEAATKIQAAYRGHIVRANPQKFILSEKKTD
VTCSSTGRINLLDAEKNLKYHSVNVAGSVVHSNVIEDRAATIIQAEIRGFLTRRHFKQEK
KEGNDAAKKIQAHIRGYLTRKHLDEVGIPHKHSAVSHLHNGL
Download sequence
Identical sequences A0A0K0JCJ1
Bm3950 Bm1_37130 XP_001898873.1.25112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]