SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0K0S7R2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0K0S7R2
Domain Number 1 Region: 15-175
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 4.58e-22
Family SMI1/KNR4-like 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0K0S7R2
Sequence length 216
Comment (tr|A0A0K0S7R2|A0A0K0S7R2_BACT3) 1,3-beta-glucan synthase regulator {ECO:0000313|EMBL:AKR35270.1} KW=Complete proteome OX=180850 OS=Bacillus thuringiensis subsp. indiana. GN=NF53_2192 OC=Bacillus cereus group.
Sequence
MDYELLKERIEIITSRIKYIGGEVQEVCIDEPSSLEQIIQVEEKLGIKLPNSFKKVLLEF
SGNFSLRWFLPDDVELPNEFTDIFCGTPHWSLESLSEFEKERKGLVDEVFSNIDDEYDVV
WHNKLAFCEVGNGDYLAFDMKDDIDAPIIYLSHDDGEGHGYKIANNFIEFIENWSRVAFV
GCEDWQWLPFTTSFESGINPDDEPAKKFRNCLELNI
Download sequence
Identical sequences A0A0K0S7R2 A0A2A8ZFF8 J7YTL7
WP_000384351.1.35694 WP_000384351.1.61243 WP_000384351.1.6816 WP_000384351.1.71242 WP_000384351.1.72484 WP_000384351.1.77567 WP_000384351.1.86374 WP_000384351.1.87947 WP_000384351.1.90466

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]