SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0K1RXJ7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0K1RXJ7
Domain Number 1 Region: 3-180
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 4.71e-29
Family HD domain 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0K1RXJ7
Sequence length 198
Comment (tr|A0A0K1RXJ7|A0A0K1RXJ7_9CHRO) Hydrolase (HAD superfamily) YqeK {ECO:0000313|EMBL:AKV66441.1} KW=Complete proteome OX=1638788 OS=Microcystis panniformis FACHB-1757. GN=VL20_1266 OC=Microcystaceae; Microcystis.
Sequence
MRQQVIDWLKENVNEHRLRHILGVETMCIDLARHHDLDPVQAGQAGLLHDLAKFFKPKKL
LKMAESAGIDVDNICLSHPHLLHADVSAVVAQKEFNVTDEEILEAIRNHTLGKPNMSDLS
CIVFIADALEPNRGDTPELNALRQLSYQNLHKSVQQTCDYSLKYLLSSHCPIHPRTVLTR
NWALQIVKEQPTETKTID
Download sequence
Identical sequences A0A0K1RXJ7 B0JP68 I4FVI9
gi|166363298|ref|YP_001655571.1| 449447.MAE_05570 WP_002763152.1.24258 WP_002763152.1.4043

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]