SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0K2JP75 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0K2JP75
Domain Number 1 Region: 49-238,268-393
Classification Level Classification E-value
Superfamily Duffy binding domain-like 4.19e-68
Family Duffy binding domain 0.00012
Further Details:      
 
Domain Number 2 Region: 561-854
Classification Level Classification E-value
Superfamily Duffy binding domain-like 4.45e-52
Family Duffy binding domain 0.00032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0K2JP75
Sequence length 857
Comment (tr|A0A0K2JP75|A0A0K2JP75_PLAFA) VAR2CSA {ECO:0000313|EMBL:ALB01000.1} OX=5833 OS=Plasmodium falciparum (malaria parasite P. falciparum). GN=var2csa OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MDSTSTIAEKIEEYLKEKSNDSKIDQSLKADPSEVQYYRSGGDGYYLKNNICKITVNHSD
SGKYEPCDSIPPPYGDNDQWKCQQNSSDGSEKPENIFVPPRRQRMCIKNLEKLNVEKIRD
KHAFLADVLLTARNEGERIVQNHPDTNSSNVCVALERSFADLADIIRGRDGNKCETKSTN
NVEELIKKFFEKNYRSNEEYKRKYRNDDENYKKLREDWWTKNRQKVWEVITCSARSNDLL
IKRRWTTSKESNGENKLELFRKCGHYEKEVPTKLDYVPQFLRWLTEWIEDFYREKQNLID
DMERHREECTREDDKSKEGTSYCNMCKEKHTKYCEYVNKWKSEWENQKNKYTELYEQNKN
KTSSSSKNTSRYDDYVKEFFEKLNEANYKSLDDYIKGDPYSKEYTTKLSFILNSSDANTS
SEKIQKNNDEVCNPNESGISSVGQAQTSCPSSNKTCNTHSSIKANKKKVCKDVKLGVREN
DKDLRVCVIEDTYLSGVENCCFKDLLGILQENCSDNKSGSSSNGSCDNKNQEACEKNLDE
ALASLTNGYKCDKCKSEQSKKNNNKWIWRKFPGKEGGLQEEYANTIALPPRTQSLCLVCL
DEKEGKTQHKTISTNSELLKEWIIAAFHEGKNLKPSLEKKKGDNNSKLCKDLKYSFADYG
DLIKGTSIWDNDFTKDLELNLQKIFGKLFRKYIKKNNTAEQDTSYSSLDELRESWWNTNK
KYIWLAMKHGAGMNGTTCCGDGSVTGSGSSCDDIPTIDLIPQYLRFLQEWVEHFCKQRQA
KVKDVIENCKSCKECGGTCNGECKTECKTKCKGECEKYKEFIEKCVSAAGGTSGSSWVKR
WDQIYKRYSKYIEDAKR
Download sequence
Identical sequences A0A0K2JP75

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]