SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0K2JP78 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0K2JP78
Domain Number 1 Region: 49-234,264-395
Classification Level Classification E-value
Superfamily Duffy binding domain-like 2.09e-69
Family Duffy binding domain 0.0000652
Further Details:      
 
Domain Number 2 Region: 557-850
Classification Level Classification E-value
Superfamily Duffy binding domain-like 5.23e-52
Family Duffy binding domain 0.00032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0K2JP78
Sequence length 853
Comment (tr|A0A0K2JP78|A0A0K2JP78_PLAFA) VAR2CSA {ECO:0000313|EMBL:ALB01001.1} OX=5833 OS=Plasmodium falciparum (malaria parasite P. falciparum). GN=var2csa OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MDSKTTIGDKIEAYLKEKSNESNIDQSLKADPSKVQYYGSGGDGYYLKNNICKITVNHSD
SGTNDPCDRKELSYGDIDQWKCQQNSSDGSENNKNICVPPRRQHMCIKNLENLKFDKIRD
KHAFLADVLLTARNEGERIILYHPDTNSSNVCVALERSFADIADIIRGTDQLKGSNILEQ
NLRRMFKKILEKDSTLKNNYSNDDENYKKLREAWWNANRQKVWEVITCGARSNDLLIKRR
WRTSKESNGENKLELCRKCGHYEKEVPTKLDYVPQFLRWLTEWIEDLYREEQNLIDDMER
HREECTSEYDKCKEVTSYCSTCKEKCKKYCECVKKWKSEWKNQKNKYTELYEQNKNETSS
SPKKKSRYDNYVKEFFKKLNEANYKSLENYIKDDPYSKEYVTKLSFILNSSDTENASEKI
QKNNDEVCNPNESEIASVELAQTSRPSSNKTCNTHSSIKANKKKVCKHVKLGVREKDKDL
RVCVIEHTSLSGVDNCCFKDFLRMLQENCSDNKSGSSSNGSCNNKNQEACEKNLDEALAS
LTNGYKCDKCKSEQSKKNNNKWIWRKFPGKEGGLQEEYANTIALPPRTQSLCLVCLDEKE
GKTQHKTISTNSELLKEWIIAAFHEGKNLKPSLEKKKGDNNSKLCKDLKYSFADYGDLIK
GTSIWDNDFTKDLELNLQKIFGKLFRKYIKKNNTAEQDTSYSSLDELRESWWNTNKKYIW
LAMKHGAGMNGTTCCGDGSVTGSGSSCDDIPTIDLIPQYLRFLQEWVEHFCKQRQAKVKD
VIENCKSCKECGGTCNGECKTECKTKCKGECEKYKEFIEKCVSAAGGTSGSSWVKRWDQI
YKRYSKYIEDAKR
Download sequence
Identical sequences A0A0K2JP78

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]