SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0K2JP86 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0K2JP86
Domain Number 1 Region: 48-234,264-384
Classification Level Classification E-value
Superfamily Duffy binding domain-like 6.41e-72
Family Duffy binding domain 0.0000531
Further Details:      
 
Domain Number 2 Region: 559-869
Classification Level Classification E-value
Superfamily Duffy binding domain-like 8.63e-45
Family Duffy binding domain 0.00087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0K2JP86
Sequence length 873
Comment (tr|A0A0K2JP86|A0A0K2JP86_PLAFA) VAR2CSA {ECO:0000313|EMBL:ALB01011.1} OX=5833 OS=Plasmodium falciparum (malaria parasite P. falciparum). GN=var2csa OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MDKSSIGDKIEAYLKEKSNEPNIDQSLKADPSEVQYYGSGGDGYYLKNNICKITVNHSDS
GTNDPCDSIPPPYGDNDQWKCQQNSSDGSEKPENVFVPPRRQRMCIKNLEKLNVDKIRDK
HAFLADVLLTARNEGERIILYHPDTNSSNVCNALERSFADIADIIRGTDLWKGTNSNLEQ
NLRRMFAKIRENDKVLQDKYPNDDENYKKLREDWWNANRQKVWEVITCGARSNDLLIKRR
WRTSKESEGENKLELCRKCGHYEEKVPTQLDYVPQFLRWLTEWIEDFYREKQNLIDDMER
HREECTRKNVESNEGASYCSTCKDKCKKYCECVKKWKTEWENQENKYKDLYKKDKRKKSS
AKHASRYDNYVKEFFKNFKGDNYKSLENYIKGDPYFAEYVTKLSFILNPSYANTSSEKIQ
KNNDEVCNCNESEISSVGQASISDSSSQKACITHSSIKANKKKECKDVKLGVREKDKDLK
ICVIEDTYLSGVENCCCQDLLGILQENCSDKNQSGSSSNGSCDKNSEDECQTKLEKVLAS
LHNGYKCDKCKSGTSRSRKIWTWKKSRGNGEGLQKEYANTIGLSPRPQSLCLVVCLDEKE
GKKTQELKNIRTNSELLKEWIIAAFHEGKNLKTTYLEKKKGDNGKKNAENKKKLCKALEY
SFADYGDLIKGTSIWDNEYTKDLELNLQQIFGKLFRKYIKKNISTDENTSYSSLDELRES
WWNTNKKYIWLAMKHGAEMNSTTCCGDGSVTGSSDSGSTTCSGDNGSISCDDIPTIDLIP
QYLRFLQEWVEHFCEQRQAKVKPVIENCKSCKESGGTCGNDCKTECKNKCDAYKNFIENC
KGGGGTGTAGSSWVKRWYQIYMRYSKYIEDAKQ
Download sequence
Identical sequences A0A0K2JP86

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]