SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0K8QCF6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0K8QCF6
Domain Number 1 Region: 177-361
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.47e-49
Family Glutathione peroxidase-like 0.00026
Further Details:      
 
Domain Number 2 Region: 67-176
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.3e-18
Family FAD-linked reductases, N-terminal domain 0.00023
Further Details:      
 
Domain Number 3 Region: 1-53
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 0.000000000706
Family PHBH-like 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0K8QCF6
Sequence length 368
Comment (tr|A0A0K8QCF6|A0A0K8QCF6_9MICC) Phenol 2-monooxygenase {ECO:0000313|EMBL:GAP59355.1} KW=Complete proteome; Reference proteome OX=1588020 OS=Arthrobacter sp. Hiyo1. GN=AHiyo1_26400 OC=Bacteria; Actinobacteria; Micrococcales; Micrococcaceae; Arthrobacter.
Sequence
MYVDLGEVDRNDNRSVRNTTIEEIISKANDILHPYTLDVRNVAWHSVYEVGHRLTDRFDD
VLPDQRGTRTPRVFIAGDACHTHSAKAGQGMNVSMQDGFNLAWKLGHVLEGRSPESLLST
YSAERQVIAKNLIDFDKEWSTLMAKKPEEFEDPTELENFYVSTAEFPAGFMTHYAPSPLI
AEPTHQGLATGFTIGKRFKSAPVVRVCDTNPLQLGHQAKADGRWRIYVFADASEAGTAQR
GSSPVADFGEWIANSPDSPLAATPSGADRDAWFDVKVIYQQEHTSVDIGAVPEAFKPEVG
PFKLTYLENVYGTDPSADIFELRGLDRGGVVVVVRPDQYVANVLPLTATAELAAFFAPLL
RSGRTAAV
Download sequence
Identical sequences A0A0K8QCF6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]