SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0K9PQ12 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0K9PQ12
Domain Number 1 Region: 32-98
Classification Level Classification E-value
Superfamily Chaperone J-domain 0.00000000164
Family Chaperone J-domain 0.0029
Further Details:      
 
Domain Number 2 Region: 267-361
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000136
Family Thioltransferase 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0K9PQ12
Sequence length 682
Comment (tr|A0A0K9PQ12|A0A0K9PQ12_ZOSMR) Uncharacterized protein {ECO:0000313|EMBL:KMZ71061.1} KW=Complete proteome; Reference proteome OX=29655 OS=Zostera marina (Eelgrass). GN=ZOSMA_189G00220 OC=Spermatophyta; Magnoliophyta; Liliopsida; Zosteraceae; Zostera.
Sequence
MGKLLQQFRQYALPLFLLTAGIFFQLIVLPSSIPYSHYDVLGIERLASNAQVEDAYQKFE
SRWNSGKVIPKIDQFIKIRYAFEILTNPIWKRDYDHFGIDEHLHIIETLKVKYKGEIFSK
INLPLLAISSYGSSYNKLTYTDFASNIRKTKVWLIQVYSSGSPQSAEFSNSWNNIVNFLD
GIVDTAVVELGELGIASFLAERRYTGQPFFRNGLPALISFPPNCRNLDCCFRYDGDNLSE
DAVIDWMTTTILSLPRIFYYSKESLGKNFIAKSGQHKVKVIFFSRTGQRALPFQRKAARD
YHDYASFAFVLWQDEDAPFWFKKFEVESAPATLLLKDPGVKPIVYYGTWNSSSFINIMEQ
NKHHDLPQLRSITSMELGCDAKGRSRAGDDSTAWYCVVLSGRLSLQLSIMRDVMRRVHKN
LVDYGSLSSIKDDFSDQGLAAVALKEKRLTLTWLDGELQSTYCSFYLHSETSYETCGPRR
YADIDDVPLLFLVRYRRNSTENNLKGEKKKKSIWDLSQDVEDSNLASQLVARYNGSEDVS
EIIKWISQTIKDGDTRDLPYFRTQTPELIPENADSVLLKSIQGVISSGGMKKRLKSINTS
IYDHVTDPRLGPFMLLGACLSFGAIYLQKNQTNSQDNKDESKPKRQRVKRTSSSKNRPPS
ITDAIPKDAEQILLPDSDPDSD
Download sequence
Identical sequences A0A0K9PQ12

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]