SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0K9Q515 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0K9Q515
Domain Number 1 Region: 304-439
Classification Level Classification E-value
Superfamily ApaG-like 2.62e-24
Family ApaG-like 0.0006
Further Details:      
 
Domain Number 2 Region: 92-203
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0000000126
Family SMI1/KNR4-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0K9Q515
Sequence length 439
Comment (tr|A0A0K9Q515|A0A0K9Q515_ZOSMR) Protein ApaG {ECO:0000313|EMBL:KMZ75555.1} KW=Complete proteome; Reference proteome OX=29655 OS=Zostera marina (Eelgrass). GN=ZOSMA_113G00430 OC=Spermatophyta; Magnoliophyta; Liliopsida; Zosteraceae; Zostera.
Sequence
MELEKMDGLVLGSILCKLGSKNASIFACVSSICKFHACDDGLWRVFCREDLDLLLPCDPN
GNSCSSFKVAYEMWRESFRSYPLELVKRCKKNWDGIKNWAADHFPEVLPTLQNGASELEI
RDLEEKLGLELPEPTRVLYRLCNGQSTQPTEMFTNIHYSLGIIGGYSFYNHTVNVHWLPL
DLVIAETNRCRIMHDDSDFIVLKCIVVACSSNVEKFFLLSCTNGMLYVGTKNFMANGEMI
PCVPKELIRMDSGGGDMTQQDGLLLWFEEHVRSCLSGKVNVQTKDDDRGINLFPQLPPLC
SNVITHGVQVCASAIYIPERSKEDKHMFSYSIRMRLLPDGCTLDSRQFNSCQLSSRHWII
RCDETVIADFSGEAVIGKYPLLSVDKREFVYESCVPLFSTNGSVEGSFTFVPGRLTNPEG
RSFEVKVGCFSLTVPDYIF
Download sequence
Identical sequences A0A0K9Q515

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]