SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0K9RPP4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0K9RPP4
Domain Number 1 Region: 24-126
Classification Level Classification E-value
Superfamily Chaperone J-domain 1.7e-28
Family Chaperone J-domain 0.00021
Further Details:      
 
Domain Number 2 Region: 190-303
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000000175
Family Thioltransferase 0.072
Further Details:      
 
Domain Number 3 Region: 432-558
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000622
Family Calsequestrin 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0K9RPP4
Sequence length 569
Comment (tr|A0A0K9RPP4|A0A0K9RPP4_SPIOL) Uncharacterized protein {ECO:0000313|EMBL:KNA21501.1} KW=Complete proteome; Reference proteome OX=3562 OS=Spinacia oleracea (Spinach). GN=SOVF_042590 OC=Anserineae; Spinacia.
Sequence
MGVRLKLAPILLATLIIFAAEAKKTSDLYKVLGVDRDASPRDIKKAFHKLSLQYHPDKNK
NKGAQAKFEEINNAYEILSDEQKRKNYDLYGDEKGGPSFDGGSAGDYGGYSHFTSGGSGG
QWQNMGGGGRSFSFSFGGSGGGNPFGFGLNDMFSNLFSGGSGSGFGGSGGSSGSTFGGSA
GSQSGFKSPPKIVRAVSSKIFEKEINGKGITWLLLSYTPSTMSVQQYELFLEEIGNSLKG
ALKAGKINCENESSFCKNQGIYPRRTPRLFVYSYITSESGSLVEYNDEWDVKSLKSFCQE
HLPRFSRRVSLNNFQPSFGAGEGLPRAMLLSTKKDTPVIWRTLSGLYRKRFIFYDSQVGD
VSDPEVKSLGVNALPAIVGWLSTGEQQILKAGISVRDLESAVQEIGILLDGFEKKNKIAS
RQTKKSESESSSKQVPLLTASNFHALCGEETPVCLIGGFRSSKARDKLESILSMVSQKSL
SRRRNLSSESKDSIYYTMVDAKKQQSFLDAFDKSGFRSSNSFLVAYKPRKGKYTAYTGDL
NAEEAEKFIGSVLSGDVQFNKTRQKPVIM
Download sequence
Identical sequences A0A0K9RPP4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]