SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0L0CR97 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0L0CR97
Domain Number 1 Region: 163-465
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 1.97e-37
Family NodB-like polysaccharide deacetylase 0.019
Further Details:      
 
Domain Number 2 Region: 59-109
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000000000314
Family Tachycitin 0.023
Further Details:      
 
Domain Number 3 Region: 118-154
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000393
Family LDL receptor-like module 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0L0CR97
Sequence length 529
Comment (tr|A0A0L0CR97|A0A0L0CR97_LUCCU) Uncharacterized protein {ECO:0000313|EMBL:KNC34858.1} KW=Complete proteome; Reference proteome OX=7375 OS=Lucilia cuprina (Green bottle fly) (Australian sheep blowfly). GN=FF38_02231 OC=Oestroidea; Calliphoridae; Luciliinae; Lucilia.
Sequence
MFLQILEIPLKIPFLTAVLGNTIKSGQNHTQRSLSNSVDCLEDLRFYRDPNRPVHKIWTS
SECSKYYLCLEGEVFNFKCSEGLLFDVVRQICDFKQNVDNCDITAETPVPKPLLDEAICE
EENHWGCGDGTCLPNEYFCDGSVDCPDESDEGWCDAENDPNAAASCDPRKCKLPDCYCSK
DGTQIPARLEPQSVPQMILLSFDDAINFENWELFSQVLFRGHRRNPNGCPIKATFFVSHP
FTNYQYVQKLWNDGHEMAVHSVTHRGPEMWWSHNATIEDWFDEMVGQANILNRFASVRME
EIRGMRVPFLRVGWNRQFLMMKEFGFVYDASMVAPFSNPPLWPYTLDYKMPHTCTGSQQN
CPSRSYPGIWEIVINQLEAGDFTCTMIDSCPPHLSGDDIYRMLTHNFKRHYLSNRAPLGL
YFHATWFKKADYLNAFLKFLDDLQKLPDVYFVTNQQAIQWIRQPTTNTDIHQFSAWGCKP
KQLDKHEMVCTLSNTCKLRSRVLQQDRYFYTCKECPAQYPWIRNEFGLD
Download sequence
Identical sequences A0A0L0CR97
KNC34858

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]