SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0L0CRQ3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0L0CRQ3
Domain Number 1 Region: 855-975,1015-1106,1168-1217,1241-1340
Classification Level Classification E-value
Superfamily Duffy binding domain-like 5.36e-81
Family Duffy binding domain 0.00058
Further Details:      
 
Domain Number 2 Region: 94-405,442-502
Classification Level Classification E-value
Superfamily Duffy binding domain-like 1.7e-78
Family Duffy binding domain 0.0003
Further Details:      
 
Domain Number 3 Region: 1702-2014,2041-2060
Classification Level Classification E-value
Superfamily Duffy binding domain-like 5.23e-65
Family Duffy binding domain 0.000065
Further Details:      
 
Domain Number 4 Region: 2087-2386
Classification Level Classification E-value
Superfamily Duffy binding domain-like 2.75e-61
Family Duffy binding domain 0.0000773
Further Details:      
 
Domain Number 5 Region: 493-731
Classification Level Classification E-value
Superfamily Duffy binding domain-like 5.1e-32
Family Duffy binding domain 0.0031
Further Details:      
 
Domain Number 6 Region: 1334-1554
Classification Level Classification E-value
Superfamily Duffy binding domain-like 1.96e-25
Family Duffy binding domain 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0L0CRQ3
Sequence length 2823
Comment (tr|A0A0L0CRQ3|A0A0L0CRQ3_PLAFA) Erythrocyte membrane protein 1 {ECO:0000313|EMBL:KNC35070.1} KW=Complete proteome; Reference proteome OX=580058 OS=Plasmodium falciparum RAJ116. GN=PFLG_00094 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MGGGNGGGGTKDEDAKHLLDSIGKKVHDEIVKNGGAEAYKDDLKGNLQKAVSTIPELAAF
SDPCKLVEDYYKHPNGGGDRRERYPCTELSGKYVERFSDTLGGQCTNEKMRSGGIGACAP
YRRLHLCHHNLENISDYDSNARHKLLLEVCMAAKYEGNSINTPYPPYQQTNEGTASQLCT
VLARSFADIGDIVRGKDLFYGNTQEKKKREQLDENLKKIFRNIYDKLDGKNGKTLQERYQ
DATGNFFKLREDWWNNNREMVWYAITCGAAGGTYFRPTCGSGERTKDNCRCAIHGVPTYF
DYVPQYLRWFEEWAEDFCRLRKRKLQNAKEQCRGKNGKDKYCSGNGYDCEQTIRGDEHFV
EGECHKCSVVCTPFVKWLDNQKLEFLKQKKKYTSEIKKYRKEITSGGGASAGGSGKKRNT
RGGSNYDGYEKNFYEQLKKSGYGTVDAFLGLLNNETTCTKNNEIEEGGQINFKNVNSGKH
SSGDGNNKTFSRSKYCKACPWCGVNGTKGNWTDKTDETCGQGKDYNNYKKTEIPILTGDK
RQLDIVRKYSKFCNSVNGKNVVTSGATGATGATAASGKNGEKSKNGNQMEKWECYYDENK
NNKDGKKDINFCVLQNNETVTSKKNSMHYNAFFWKWVYHMLHDSLEWRKELDNCLKNENK
KCIKLCHGKCDCFAKWVGQKKKEWEDIKKHFKTQKITGDVGDLMVWSHDVLLELLLKKEE
LLEIIEGTYGNAKETEHIKQLLNDKAAVADILGGGENKTTIDKLLEQELKEAEECIKKHK
CQEPPPINPAGDRGVGRSEDFQQPTPSRNDESEEQEEDESEEEEEEEEDEDHGPDDGGSD
GAEETATEELPGPPTPATTPGVNPCDIVATLFSDTTKFSDACTLKYRTKSHVGWKCISET
TTKSGDTGSSGAICIPPRRQRLYVGKLHDWASGNTQVGGDSSQGDAASKDPKVELRTAFI
QTAAIETFFLWDRYKKEWHHKNKAQNGLVGGLASTLDGGSVDGGEQTPEQQLQSGKIPPD
FLRLMFYTLGDYKDILDGKNYILIDTKNGDKDIAEREKQIKDAIDKVFPNSGNKEHSGQP
ITRESWWENNAKHIWHGMVCALTYKETSGTAEGAKIKQNSGLKDKLLDNNNKPKNGNDYN
SVKLEENSGTSPKTTQAPGTSDTPTLNNPKLKDFVEIPTFFRYLHEWGETFCRERKKRLE
LVKKGCRQKHDGGDTFCSGDGHDCTEKGERRHTNMFADLDCSDCHEKCTDYKKWIEKKLE
EFHKQEKKYGKEFGQLNGNSSAGDNNCCEEIKKHTSASDFLKDLKHCKDAQNNSGEKGNE
LDFTNTKTTFGPLDYCKACPYNIVKCNSGRKSGTNGCNVNGNGETWEKVFEGISGNGEKT
TINVEMVDRRGINIDKKFEQLFKESYLFKSVREQNWECKVINNDTDVCKLTNFDETIDLN
DYTTFKVFLEYWLDDFLYGYYLLKKRKIIEKCTQKEGKTCNENSKNDCACVGKWVQQKGK
EWESIKDHFQKRQYGNGHDMAYKVTSYFEKNENELRKWIDNYDVLKNNEEYEDCINDGTC
GPNNKGIKKDMVSFLLSEIKEKIHNANGKPGEPQPNCDEIPPHSDETLEEQTDDDTTDNQ
SPAFCPPPPPPMTCVEEIAKKLREEAEGKINDELKGTALELNAKCNKVQKNDTPANGKNS
CNFKTTYENSVKQITKICERIGMNRLKIDQEWNCKHIKDIGKHLCIPPRRKDMCLKGLSN
IGKYNVNNSTDLLQKLQEIAQNEGDDIIKKLLEQNSCDEHRICDAMKYSFADLGDIIRGR
DLLNKNRKEKGIQTRLGNAFENIYKNVHDNKKAQYGKEIPHYYKLRSDWWDANRRDIWKA
MTCNAPHDAKFLKKDPNVSSGKLASSSNGIFSNDPKCRHLKDPPDYDYIPQPFRWMQEWS
ENFCILLNEQIKIFQKECEHCKNNALLCEDNENGKKCEKCKKQCENYNTLIHKSILEFDK
YKDVYKEIYNDNSKISSEIYVKNFLEKLKDKCNEQNSADKYLDEASHCKKYKFSNVIDSN
NNDNYAFKNPPKDFEQACKCDAPDPLDKCPNTEENKGACEKLSIENACKNKDFNNDDDSW
TSVDVKDSKGKNHGVLVPPRRRHLCLRNITSNTKSINNKKIFKNELLKSAYSEGYYLWDK
YKHDSTTLLDVMRYSFYDYGDIVKGTDMLDTTSSRQINKRLTELLNASKNGPANVGSWWR
KNKTHVWNAMVCGYQTGNGYKPINAIWCSVPTHDEKTHQFMRWFREWTESFCIQRKKLYD
IMVNNCNEARCDKITGKVDLYECTKACTEYENYVSKKKNEYFSQKQKYDKDFKDSYNNKD
APNYFKYSFYSNNLNCLFDNFNEKKKWENPYDSFDDTKNKEKCECIQLIIPTKRKEKEEP
KEPVQPPKKPEVPPPPPPPPLPPSDEPFDPTILQTTIPFGVALALGSIAFLFLKKKTQAP
VDLFSVINIPKSDYDIPTLKSSNRYIPYASDRYKGKTYIYMEGDSDEDKYAFMSDTTDIT
SSESEYEELDINDIYAPRAPKYKTLIEVVLEPSKRDTQKKPFITSIHDRNLYSGEEYSYN
IHMSTNNVDIPMSDKNDVYSGIDLINDSLNSNNVDIYDELLKRKENELFGTNHPKHTNTH
NVTKSSNSDPIDNQLDLFHTWLDRHRDMCEKWDKNNKVDILNKLKEEWENDNSNSGNKTS
GNITPTSDIPSGKLSDIPSTNKMLNSDVSIQIHIDKPNQVDDNIYLDTYPDKYTVDNINP
VDTHTNPNLVGNINPVDQNSNLTFPSNPNPAYDNIYIDHNNEDLPSKVQIEMSVKNGEMA
KEK
Download sequence
Identical sequences A0A0L0CRQ3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]