SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0L0CRS1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0L0CRS1
Domain Number 1 Region: 57-332,355-468
Classification Level Classification E-value
Superfamily Duffy binding domain-like 9.94e-82
Family Duffy binding domain 0.00035
Further Details:      
 
Domain Number 2 Region: 1555-1918
Classification Level Classification E-value
Superfamily Duffy binding domain-like 7.98e-81
Family Duffy binding domain 0.0000401
Further Details:      
 
Domain Number 3 Region: 795-902,934-1045,1095-1138,1168-1268
Classification Level Classification E-value
Superfamily Duffy binding domain-like 3.53e-79
Family Duffy binding domain 0.0011
Further Details:      
 
Domain Number 4 Region: 2004-2354
Classification Level Classification E-value
Superfamily Duffy binding domain-like 6.54e-71
Family Duffy binding domain 0.0000603
Further Details:      
 
Domain Number 5 Region: 461-688
Classification Level Classification E-value
Superfamily Duffy binding domain-like 3.79e-33
Family Duffy binding domain 0.0027
Further Details:      
 
Domain Number 6 Region: 1261-1460
Classification Level Classification E-value
Superfamily Duffy binding domain-like 1.7e-24
Family Duffy binding domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0L0CRS1
Sequence length 2934
Comment (tr|A0A0L0CRS1|A0A0L0CRS1_PLAFA) Variant surface protein {ECO:0000313|EMBL:KNC35023.1} KW=Complete proteome; Reference proteome OX=580058 OS=Plasmodium falciparum RAJ116. GN=PFLG_00036 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MVKQVKPDGVIEDTTAKHIFDRIGKIVYETVEKDALPYENELHGLLTNATFEKNPPGKQT
PARPCKLNHEYHTNATNGRSYPCRKGTEKRFSEVSGGECDKNKIRGSKGDNEGACAPYRR
LNLCVRNLENISDFNNINNDTLLADVCLAALHEGDSIRSDHYKYKLTNSSSQICTMLARS
FADIGDIIRGKDLYLGDNGKDRLEENLRKIFKKIYDNLVEKKKEAKDYYKDTTNYYKLRE
DWWNNNRKMVWYAITCGAAGGEYFRKTCGTGTPTNKQCRCTTRVVPTYFDYVPQYLRWFD
EWAEEFCRLRKHKLQNAIKNCRYDENNKERYCDLNGYNCKETIRGKDILVEGEGCKKCTV
PCDNFVHWIDNQQKEFLKQKNKYAEEIKKADGKNGTSNGKINNTYEKEFYTELKKNYQDV
DKFLDILSKEQICQSQPKVGNEIADAADFTKDKTEETFSHTEYCQACPWCGVKDGGPPWE
AKGDGECKKTRENPTYKSTEIPILTGDKTKSDMVQKYNKFCKNNGGNDATGATPTAKDGE
NGKKGNQIETWKCYYDESKESGQNNNCILGDWQKVTQKDKIMPYHPFFWKWVTEMLIDSM
YWRKELKSCINNNKNTCRKGCHDKCECYKRWVKQKKEEEWKQMEKHFKTQDFGSPVGLLG
QFGYDAVLQQVLDIQDLFENIKDTYGNVKELEGIKKMLEKEKSQEVVGAVTENKNTIDLL
FEDEEKEAEKCKDCPLPEDKSPGRALNQRPDEPTASDDGHDDVHDNEIHQRDLNIEDDVE
EEEGSSEDTNGATEATTTQDGVKPACDIVADIFSNVDTLKQACSTKYVNGREKFPNWKCV
PTSDKSDASGSICVPPRRRKLYIHDLQSLSGEDGKTQSHKQLLEWFVKSAAVETFFLWDR
YKKENKPQNTSQLQTLDGSSGDDEDDPQNKLKSGTIPSEFLRQMFYTFGDYRDIVVRGGG
DVNSGSEKEGGGSSSNEKNLVVLLSENKQEMEKIQQEIDKILKQSGSKLPGVPPKPSVEN
PRVKWWDTNAQHIWNGMICALTYKDSGDKKIEQVKTANGDDLFQELKNGNDYDKVSFGGT
EGPINTNAGKDAHKGTKLKDFVNRPTYFRWLEEWGEEFYRKRTHKLTKAKNKCQGYNANY
NRIYCSGDGYDCTDNDLKYNNIYAALNCRHCHKQCRNYKIWIKNKEKEFDNQKKKYEMEI
PKLKANSINNGQDEKFYNYIKNYSTVDKFLASLNQAKEYEDNIDQENKIDFNNNRKTFGP
STYCKACPLNGVTCKSNGKCEENKEKVQNNAKGEPTDIHMFVDDKSTNVIEKKLQGKCKE
YGLYKDLANQVWTCQKKQDAVDYCIIKDFVKSEYYDEKIPFNILFHRWLIDFIQYYNKSK
ETITRCIKDVNSCKEGCKDNCDCVDQWINKKCSEWEIIKKYFKAYLQTNEERIAYTIKTF
FQQGLFENDYKKAEEVLDDKNQKEIEKLWGCTGGITCNTDDEEQLHGDFITNLIKKLKEK
IESCQKKHTETSGNPSPPCVDTPPLVEEEINPLDEDTTDIQKPLFCPTEEDDGQESEEEE
EVCEMVKTLLDKSNGGTSGINDCNPKDHPNKDSYPKWDCTTSKIKTGEEGACMPPRRQKL
CINDLKVLKDQSDANKQDLKKAFIKCAAIETYFSWHYYKSKKRGVDTQKQLKEEKIPDEF
KKIMYYTFADYKDICLGKDISSDQNIQDISKKVNDILNGTNRKSGSTECTPETWWEKYGH
EIWEGMLCALTHEIDAEEKKNKIKTTYKDPPHDFAKNPQFLRWFIEWGDQFCRERVVKIE
ELKNGCNDYKCENTDEDKKQACKTACEDYKKWLKDWKDQYEQQTAKFDKDKKAGKFDGTS
AEEDVDVSSVHEYLQEQLEKLCKNSDCACMKNPSTKDEETELLGENYFPEAMDYPPKEIN
KKCDCAIPPEPMSCVEQIAKHLREKAEKNVKNYESSLKGKPGNFNNNCNQIDEAIKGDNG
SRTINKNKLNTTFPSNGESCENVGTDRLKIGQEWKCDKINNTEENICFPPRRQHICLKKL
ENMKNSVIDNNEKLLKAVMEAAQYEAIDILKKMKPEKEIKFCEICDAMKYSFADIGDIIR
GKSKIKTNNGDNIEDKLKEIFTKLKSGNSSLNNMELTQFREKWWDANRKDVWNAMTCVAP
NDAHLKKKTLNNSGHNSHTTDSIRGTQEKCGYDKEPPDYDYIPERYRFLQEWSEYYCKAL
KEKNDEMKNKCSECLRNGTCENDKNDNTCEECKKKCEDYTKFVDKWKAQFEEQNEIYKTL
YIQDRTHGPNAARRNPSIKFLKKLEESCDNPYSAEKYLDKSTHCTDYKFSETNNNENDAF
SPYPNDYKEQCKCKEKSENNASPGDTRSLPPEWFLPKIPGIKTIQNVVPRIPNRIKNIMP
DAHTIHAIVARSFDYFVPKFPKEFKPPPTNNILNEVLPSAIPVGIALALTSIAFLYLKKK
TKASVGNLFQILQIPKSDYDIPTLESKNRYIPYKSGPYKGKTYIYMEGDSDSGHYYEDTT
DVTSSESEYEELDINDIYVPGSPKYKTLIEVVLEPSGNNTTASGNNTTASGNNTTASGNN
TTASGKNTPSDTQNDIQNDGIPSSKITDNEWNTLKDEFISQYLQSEQPKDVPNDYRSGTI
PTNTNNTTMPRHNVEEKPFITSIHDRNLYTGEEINYNINMSTNSANNDLYSGQNNLYSDV
DSTSGNRDSYSDKNDPISDNHHPYSGIDLINDSLNSGNQPIDIYDELLKRKENELFGTEH
HPKRTTTNHFATPTRDDPLHNQLELFHKWLDRHRDMCEKWENHHERLAKLKEEWENETHS
GNTHPSDSNKTLNTDVSIQIHMDNPKPINQFTNMDTYPNNSSMDTILEDLDKPFNEPYYY
DMYDDDIYYDVNDDNDTSTADSNAMDVSNKVQIEMDVNTKLVKKKYPIADVWDI
Download sequence
Identical sequences A0A0L0CRS1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]