SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0L0CSL1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0L0CSL1
Domain Number 1 Region: 59-265,295-402,440-499
Classification Level Classification E-value
Superfamily Duffy binding domain-like 3.27e-82
Family Duffy binding domain 0.00023
Further Details:      
 
Domain Number 2 Region: 871-969,1028-1050,1086-1177,1225-1395
Classification Level Classification E-value
Superfamily Duffy binding domain-like 6.93e-79
Family Duffy binding domain 0.00071
Further Details:      
 
Domain Number 3 Region: 2109-2467
Classification Level Classification E-value
Superfamily Duffy binding domain-like 1.96e-62
Family Duffy binding domain 0.00016
Further Details:      
 
Domain Number 4 Region: 2479-2766
Classification Level Classification E-value
Superfamily Duffy binding domain-like 4.05e-54
Family Duffy binding domain 0.0000754
Further Details:      
 
Domain Number 5 Region: 1700-2024
Classification Level Classification E-value
Superfamily Duffy binding domain-like 7.06e-48
Family Duffy binding domain 0.00032
Further Details:      
 
Domain Number 6 Region: 1400-1598
Classification Level Classification E-value
Superfamily Duffy binding domain-like 4.71e-37
Family Duffy binding domain 0.0067
Further Details:      
 
Domain Number 7 Region: 531-557,591-735,778-798
Classification Level Classification E-value
Superfamily Duffy binding domain-like 9.81e-32
Family Duffy binding domain 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0L0CSL1
Sequence length 3206
Comment (tr|A0A0L0CSL1|A0A0L0CSL1_PLAFA) Erythrocyte membrane protein 1 {ECO:0000313|EMBL:KNC35323.1} KW=Complete proteome; Reference proteome OX=580058 OS=Plasmodium falciparum RAJ116. GN=PFLG_00424 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MAPQGGSRGGVGEIDDKDAKHLLDSIGEKVYKEKVKNGANDFSDELKGNLNTASGSGGEL
ASTTDTCALVEQYRSKADTKSERNPCKELSGKVEPRFSDTLGGQCTNEKMRSGGKGACAP
YRRLHLCHHNLETIETTSTTKHDLLAEVCYAAKEEGESLKNYHAQYQTENTDFKTNICTV
LARSFADIGDIIRGKDPFYGNTQEKEKREQLENNLKEIFKKIYDNLDKKDRYKDTTNFFQ
LREDWWTANRETVWKALTCSEQLSNASYFRATCSDERGGALANHKCRCPNGKNADQVPTY
FDYVPQYLRWFDEWAEDFCRKRKHKLENAKNKCRRPNGKDKYCDLNRHDCKKTVRGDHVF
FEDDDCNDCSVACKPFVKWIDNQKLEFEKQKKKYKSEIEKYTNGESRGTGGSKRKKRGAG
KSNYDRYESKFYNKLKEKNNYGTVDGFLELLNKEKTCTKNGDIEEGGKIDFKNVNSAKNS
GGDGNNKTFYRTKYCEACPWCGIEEQKVDGKWKAKNDGDCNPGKDYKNYKKTEIPILTGD
KTKGNMVKKYNKFCNANDGNGAPVAAPDTATSGHNTDYATTGYCGGTNNSDKDPSLCEKW
TCYYKKNGKDVGKEDINFCVQQEQDTDKKKEMSMHYNAFFWDWVYHMLHDSLDWRNELKS
CIDKDKSEQCENKCNSKCDCFLKWVNEKKTEWDKIKEHFYKQEGFDNKGENGISVGGLGM
THDFVLNCLLKKDLLLKSIKDTHVDAKDIDRIDKMLKEEENQVTGVASGVSGTGSANGKN
SIIDKLLDHELTDAQNCLKTHTSDPCPQQESLARSDEPQPRPAEEGAGDGSDDASSEDEE
EEEEEEEEKEPEADETHTEDTEGDETETTDQEVQPPPDACSIVKTLFTTGDAKTNFKDAC
EQKYSIPNRYWGWKCIPSGDKIATSRTTRDAGDSTSGKDGATGGLCIPPRRRKLYVGELT
KWADTVGDKGESQTLTGGEAAQGTEASASSSSSDSNSVRQTASDSSAQTASQPNSRPTPA
TSSQSPSDPLLTAFVESAAVETFFLWHKYKMDKEIEKKERKQAETGLVASETSDDPEHPQ
NQLKKGIIPDEFKRQMFYTLADYRDILFGNTDIVSKASSDDKKSMETIEKKIEEIFPKNS
DSKPASGKNPNEKREQFWKKHGKDIWQGMICTLSYDTKTKDKIEGVYEKLIDTDKENMYD
KVTFKGGFDEIGAGARNPDDPPTGKTKLEKFVKRPFFFRWLEEWADEFCRKQKHKLYIIK
KECKVDDDDNKCDGDGFKCTQTITDEDETIKGFDCPSCAKECTKYRKWIERKKTQFEKQD
KIYKEQKKNCKNESENTERNKDGNGFYETLTTSTTAAEFLQKLGPCSKTNNGGSEITFDD
SGDTFKPAKDCKPCSKFKIDCQKGNCGGSANGKECKNNKITAENIKGEKNGNDVVMFVSD
NSKKEFDGGLKDACEHSNIFKGIRKDVWTCDKFCGLHVCGLKNDNGKNNGQIILVRALFK
RWVEYFFEDYNKIKHKISHCTKKGEEPKCIKECVENWIKEKEKEWTNLKNLYLDQYKNAD
ESYPVKTFLEELIPQIAAATDKAEHETLKKLEKSLGCNGTENSKESKKDENNDLVLCLLT
KLGKEAEQCKDKPPNCDNSSHSDETLEEQTDDDTTDKQSPEFCKDIQPPEEPKEDSDILC
NDKQEAKCDDFKKIYNNSTCEPKRKLIGLGAQYHKAGRFYPNVYISPRVNQLCLKPLKEL
ENSNEGTTDKSKLIDALKKCAYNEAKGLYKYYNDNKKTFENNGSTLSEKEIETYTLEAMK
RSYADYGSIVKGDILWDYEDRKKIDEKIMNFAEKHNTSIEESRLAILDDDDVKRQKLWES
IRTDVWKSMLCGHKDAIGGDTNSLSNGLDFCKLPTTDEEYPFLRWFVEWGQNFCIRRDQE
LKYLKKQCQNVMCNDSDESKKQACQTLCKKYQEFLINSKIQYETQKPEYDNLMSSIPKHR
KKDAIEFLKEKCNPQFSCFKDINENESNKIFQHASDEIIKFCTCTSEDTSKSIPSNCIDK
AAYELQKEATNKLGNASNSLKGNQNNISFKDCRRGDYVVVDNTLGKKIDKDKLEIEFPSN
SYSCEPNEINSFHIGKAWDCNNTNINIREKYLCLPPRRRFMCLRKIERMITKDVDDKDKF
FQVVMKAAKEEGIRILKNYKEQNKTQFSEICDDMKYSFADLGDIIRGRDLWKEYPKYHTT
EQNLQRIFKNIHNEITKGGDKDKYKYDAQYFHELRNDWWNTNREAIWKAITCSTPRSAYI
YKKTNTGENIRSTDMYYYCGYTKEPPYDDYIPQRLRWMKEWGEYVCKILNEKIDDIKKEC
DKCNLNDQNCLNKDDGNKCKSCKEKCKEYTELIHNLKSQFSILEKKYNELYTKAKNNSGG
FIKDNDKYVIEFFEKVIKEKLCDVETPDKYLDKTIHCINYKFNEKEKDNETYAFNVNPKV
YTQKCTCAITNDPLDKCPDQNTCTKYHAIQCFGKEHDDNAYWLSTYIKDNKAIIKNVLLP
PRRIHLCLRIDAEQIDHLRSEIENFKNFICSSAFSEAKRLKKVYKDDNDKLLQAIKYSFS
DIGSIVKGEDMKEGTASDNIAKIFNGKKFSETNRKKWWNENKYHVWESMLCGYKEAQGDT
KKSENCRFPDIESVPQFLRWFQEWTEIFCTRRNELYDKMVTECQKAECVISKGSVDKPEC
MKACEKYKYYVLSKKKEYDIQRDKYDKEFKMTLKSKTAPEFLKVPCLSEYFSEKIKWENP
YKSLDDDTLKGNIYSGIYKKTKSSVGNLFQILQIPKGDYDIPTLKSKNRYIPYRSGPYKG
KTYIYMEGDSDEDKYAFMSDTTDVTSSSESEYEELDINDIYVPGSPKYKTLIEVVLEPSG
KLSGNTIPTSGNNTTASGKNTPSDTQNDIQSDDIPSSKITDNEWNTLKDDFISNMLQNTQ
NTEPNMLGYNVDNNTNPKTLHVSMDEKPFITSIHDRDLYSGEEYNYNVNMSTNSMDDPKY
VSNNVYSGIDLINDSLSGAKPIDIYDELLKRKENELFGTNYKKNTSNNNVAKLTNSDPIM
NQLDLLHKWLDRHRDMCEKWNNKEELLDKLKEEWEQDNNSGDIRSDNHVMNTNVSIEIDI
DENKGKKEFTNMDTNVDTPTMDSILDDIEDDIYYDVNDENPSVNDIPMDHNKVDVPKKVH
VEMKILNNTFNGSLEPEFPISDVWNI
Download sequence
Identical sequences A0A0L0CSL1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]