SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0L0CTY8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0L0CTY8
Domain Number 1 Region: 465-766
Classification Level Classification E-value
Superfamily Duffy binding domain-like 4.19e-52
Family Duffy binding domain 0.0000229
Further Details:      
 
Domain Number 2 Region: 157-434
Classification Level Classification E-value
Superfamily Duffy binding domain-like 2.49e-48
Family Duffy binding domain 0.00000376
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0L0CTY8
Sequence length 1352
Comment (tr|A0A0L0CTY8|A0A0L0CTY8_PLAFA) Erythrocyte binding antigen {ECO:0000313|EMBL:KNC35691.1} KW=Complete proteome; Reference proteome OX=580058 OS=Plasmodium falciparum RAJ116. GN=PFLG_00910 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MRKTLKLFYISGFLFSSRALCKLENYIKNEYDRENSFYILNNKVEKEYEKGTNNNINIDK
LANGSLEMLESIGNDLLYKKGKLNFLYEYGMELLHINKVPMNRMNNSRGLGDSNMSFLDI
SNNNMNSLNSMNNLNNSNNFDSSNSLSFVDMKSIHRCIKKRAKGERDWACNDKNTKEPNI
CVSDRRVQLCTGNLIELPINDSTKEKFKEKLILAAQKEGSLLFEKFGKKYNEEFCLNLKW
SYGDYGDIIKGTDMEGLGRSIKVEFEIDRIFKRDNEKSAENRKKWWEEISTHIWNAMIKE
HKEKFPKDVKECSADKPLDEPQINRWLMEWAYDTDYNKNLWYNKLDDSKNKCNRICPKEE
ICKSECKKYKAWIDKKNNDFTILSEIYLKYNKKSSLYKTAFEYLKQKWDKYKELNFSSIF
DQLNAKYYNKCICQNNKIENNALYVKIEDICNNTKVKSIYGELYCKEKGNDKIWQCINEH
IKDFPDVCGPPRRQQLCLGNLDKDEFKNVNDLKKFLNEIILGIRDEGKFLIEKYRKNMHE
NMYLDERACKYLNYSFDDYKNIILGKDMWRDPNSIKTENILKGNFEGIKANIVSMYPSYA
DLSLDEFRKHWWDQNKKQLWEAISCEFYKGNHTGVCLMEDDNDNQYLHWFREWKNDFCID
KLKWNDVIKEPCIDKKVKSPKPSENPSDVATVCNKSCTDYDKWIINKRKEYKMQSSKYKR
DRSLFNNVIQNLKPWEYLSMKCTECTCNLDTQTFVYPYKGYEDICKSTVKPYDPEDIKDE
EFNEPSLNVNPLSLTSQDVTERVSSVDDVLSIKENVDLKPFKPKGDTQSSHVDQVGNTRE
GESKPSGANGREDPSTESSTYNDGVITSSSSLGSSSGSDVSSSPVGVGDEHEAKELLPPQ
KIIDGVTQSDESTLSQHGKESSQERRNLDGSSLSRHSNQDEERSIITSDVEHGTNSLFGS
QIQDQETILGESEPLTTSPPEHETSKMDTHAGGKNMEQVRNASVDSSSEMSNGGRGGLKT
KEMKGEEVTGITSKNDINLEDSTVHSRQNKIENSGDNTQERGDSVLESEFSKLNRTSHTH
DNNRIETTAENNIGGLSNSNVHDGRDSQRNRMHINSRSRHGSLESDIVVRGDDISNIEGG
EEEEEDANTLKYPRNVLNNKNSRTYNIEEYIYRDVNKVADDIMRSYKSNRCTNNLSSNYC
SKLKKESLSNSCTNEDSKHLCCSISDYCMKFFNFNSSGYHSCMRKEFSNHAYKCFAGKGF
SNMYYFAGGGLFFIILFLLGAKSSILNWSEDNELNGTAFEEANFEDAAFEVTTGQDSAFE
DYDENAYRIGLLMNQKIQSAKSSDYLEYHVDN
Download sequence
Identical sequences A0A0L0CTY8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]