SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0L0CVI7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0L0CVI7
Domain Number 1 Region: 812-895,927-949,985-1064,1098-1267
Classification Level Classification E-value
Superfamily Duffy binding domain-like 2.09e-87
Family Duffy binding domain 0.00037
Further Details:      
 
Domain Number 2 Region: 69-277,308-351,381-498
Classification Level Classification E-value
Superfamily Duffy binding domain-like 6.54e-84
Family Duffy binding domain 0.00023
Further Details:      
 
Domain Number 3 Region: 1940-2283,2313-2331
Classification Level Classification E-value
Superfamily Duffy binding domain-like 5.1e-69
Family Duffy binding domain 0.00024
Further Details:      
 
Domain Number 4 Region: 1618-1934
Classification Level Classification E-value
Superfamily Duffy binding domain-like 2.75e-53
Family Duffy binding domain 0.00029
Further Details:      
 
Domain Number 5 Region: 527-692,720-740
Classification Level Classification E-value
Superfamily Duffy binding domain-like 1.03e-37
Family Duffy binding domain 0.0042
Further Details:      
 
Domain Number 6 Region: 1308-1482
Classification Level Classification E-value
Superfamily Duffy binding domain-like 1.06e-26
Family Duffy binding domain 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0L0CVI7
Sequence length 2374
Comment (tr|A0A0L0CVI7|A0A0L0CVI7_PLAFA) Erythrocyte membrane protein 1 {ECO:0000313|EMBL:KNC36455.1} KW=Complete proteome; Reference proteome OX=580058 OS=Plasmodium falciparum RAJ116. GN=PFLG_01781 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MGPPVATQNGGGSSGAAGSSGKDKYDDAKDLLDKIGEVVQKQAYSEALRCGRSALQGRLS
DATYPNDKRPVRTTPKDPCELQYEYHTNVTSNVVDPCNKRSGKRLSEVHNSECDRKKIKD
STSDTVGACAPYRRLHVCDKNIQQIKTENITTHNLLVDVCLAAKFEGQSIRGYYPQYETQ
YPGSGSDFPMCTMMARSFADIGDIIRGRDLYRRDKGKREKLEEKLKQYFKNIYDKLGDEA
KDRYKDTENYFQLREDWWALNRQEVWKAITCDAPDYAKYFRGTCGGDDNENTTIRTPSQC
RCGDGDVTIVPTYFDYVPQFLRWFEEWAEDFCRKRKHKLENAIRNCRGEDKDGKDRYCDL
NGFDCTKTARGAEIFVKGDDCHKCSVACDRFVKWIDNQQKEFEKQKKKYAEEIKKADGRN
GTSIRIGDTTINNLYVQEFYQQLQSSCKDVNAFLKKLSEEQICKDKPQASGETADHVDFT
KDETNGTFSRTEYCRACPWCGVNGTKGNWTPKGDKTCGSAKKKTFTEENTTDIEILSTDK
GKSKILEKLKTFCRDNKEINYDIWKCHYDDNDTDVQTDDSDNCILGDWQNVKEEDKIMSY
NAFFWKWVHDMLIDSIEWRTQLKSCINNETKACKNGCNTKCDCFKKWVEKKKAEWGKIKE
HFKKQKGFSIFGDNYDFALNYLLKKEELLENLREAYGNANEIKRIEELLEDEENVVADNQ
KKTTIDKLIEHELNDATKCKQDCEQPPPQPPVGDPGVARSLPSSPPAPSSPPEEKEEEDD
SSEEEEEEEVEEETTKDSAATEVTGQEEGPPEKKEEVEKVNPCDIVATLFSDTTKFSDAC
TLKYRTKSHVGWKCISETTTKSGDTGSSGAICIPPRRQRLYVGKLHDWAKTSGNTQSVGG
NTGSGDSTGARSDPQGEDAASTSTSQTSLLHAFIECAAIETFFSWHEYRMEKKPPSEQNA
GAAALVLIGQQQSQQEDPQDQLNGGKIPEEFIRQMFYTFADYRDLCLGKDIGSDMDEVNE
KIDTVFPKNRKGGGSPNKQERKNWWKQHGHGIWEGMICGLSYDTNNKTFIKEVRTELTKN
NNNYNDVKFPSQSGPSANSKLEEFARTPQYFRWFQEWSEDFCRKKKMKIGKIINECRGKD
KDKYCSGDGHDCKVPDASRNDSFIYSHCPDCQKQCIKYKKWIEKKKNEFNKQKKKFQNEI
NNVRGTNENKYDEEVYKILKGKYPLFQNFVATLNEGPYCNNENLGGKIDFNKNGETFGSS
EYCKACPLYGVKYNITSRKYEPINEETYKRTKVSTRENKDDKIPTIIDVLVLGRKREDEN
KYHNEDCKMTDLIEDASVQNWECQKINGVDQCNLTNFSGDIDDDQNMEFNVFFQRWLRDF
VHDYNILKGKIKACIKMENEKEDKCFKGCKENLECVKKWLDEKAKEWNQIKIHYEKHAKF
LEPSIPYGVKRYFDQLHFDNDHIKAQDVIEDENERKKIWGCTGRDDCTTEEKEKNDDFIT
NLIDKLQKKIHTYKTQHGTKPEEQCHPPPPNTLENHLEETTPPSGNDDPDNDTQKPAFCL
TEDTTTKEKEEDVCEKGIVDCTKVGKNDKIQVPMDAKPGDPSRNNDADNTSCGGIDINEN
GKWKSTAQLKYPKGSEEIYVSPRRQKFCVHGLQDATDETELKTKLLNASANQGYNLAIKY
DYYKKKYFVHPCNALKYSFYDYQHIILGNDPLEPENWSTETALKRIFKKAYASSPNASQP
LSNERQEFWKTNKECVWSAMKCGYNERRKNGGSDAPDINDCTNDTPTEFDKVPQFFMWFT
EWSEDFCNHRKEQLKKLVDKCRECKLRNDGRCEIYGEECIDCKTACKAYEEFIEKWRTQY
EQQNTKFMTDKHKCKDDPDAKSSENAYKYLAKKLENITCTNAHCNCMKEPLSKNPNIPAS
LDYPPIEIEGRCTCGPPPPPPLQQDACEIVRILLEGKNGTTAIDGCEPKTKGSYPEWNCT
TSKIKSGEDGACMPPRRQKLCVHNLEYDINVSSTEEDLRKAFIKCAAKETFWLWHKYKED
KGKEKQNSEGSTNPNELDNELRKGVIPQEFKRQMFYTFGDYRDLCLGSDIGNDVERVKNN
IMFVFSELYLEKMKPEVWWNEYCPQIWEGMLCALSHAVRGSDQGSIKNNNKYSKVAFSDD
PTVTTLYEFAQRPQFLRWYIEWSDQFCQKQKREYNDLYKKCKTCGNSNGNITTDECKNKC
KDCKNQCKKYNQFITEWQKNWEKQSEQYQKLYKKTSDTTNTNISEQEKLVIEHLKNLKEK
NGKTNKYSNGGKYINDKGYIADCREQTNFSKDEDESKYAFRNYPNNYQKKCTCNPKPPIP
PPSPPSNNTSDILQKTIPFGVALALGSIAFLFLK
Download sequence
Identical sequences A0A0L0CVI7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]