SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0L0CW06 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0L0CW06
Domain Number 1 Region: 4-169
Classification Level Classification E-value
Superfamily Duffy binding domain-like 1.05e-16
Family Duffy binding domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0L0CW06
Sequence length 618
Comment (tr|A0A0L0CW06|A0A0L0CW06_PLAFA) Erythrocyte membrane protein 1 {ECO:0000313|EMBL:KNC36478.1} KW=Complete proteome; Reference proteome OX=580058 OS=Plasmodium falciparum RAJ116. GN=PFLG_01821 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MLNDDLAEKINKIFDRIKPDNEQKPNGHDKKEHCNEYEEIDKTPQFLRWLEEWARKYCTE
KSTRAREINETCEDDIINKIHTYSIDNIPDEPCKTALTKYRNWYNNNYLHWENLKKKYES
NKKNEKEQTTNGAHLSPSTTTSFYKDDDAEAYVKRKCKECTCNYKDLQEEYKRITEGNNE
VSTLIHRARIDSFDLKKRLFYNILTLGSHYGFQAATNVISGLNRTISSFTRDQGQSRDSN
SPDQTTQRDDGDEPPLPDGPPGKVPATDQITNALLGSAIPLGVGIAFASLAYLLLKVKPK
ITSTRTNLFRVIDIPQNDYGIPHKTSINRYVPYSSNLYKEKTYIYIEGEETDDYSYVRVI
SSSDITSSSEGEYEEMDINDIYPYKSPTYKTLIEVVLKPSIKNEEAHNTEDAQDILIENM
EDTNDTPTNKLTDEEWNKLRNDFISQYLKDLPNGMDYQLPNEYTVDDNIYMDIEPNILHD
SMDEKPFITQIQDRDLHNEKFSNKNEWLNKLNEECKNNNNIINNILNLTTNIPIDVIMDH
PSTPNNDMTFIDMYSKNNNVLDEIENNIEKRYENNIYDNFSDDPTKTKKKKTNNIIRLSI
NPNLKDTHNISVSNIWNI
Download sequence
Identical sequences A0A0L0CW06

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]