SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0L0CW42 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0L0CW42
Domain Number 1 Region: 40-300
Classification Level Classification E-value
Superfamily Duffy binding domain-like 1.44e-51
Family Duffy binding domain 0.00019
Further Details:      
 
Domain Number 2 Region: 498-592
Classification Level Classification E-value
Superfamily Duffy binding domain-like 0.0000000157
Family Duffy binding domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0L0CW42
Sequence length 604
Comment (tr|A0A0L0CW42|A0A0L0CW42_PLAFA) Erythrocyte membrane protein 1 {ECO:0000313|EMBL:KNC36477.1} KW=Complete proteome; Reference proteome OX=580058 OS=Plasmodium falciparum RAJ116. GN=PFLG_01820 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MELIPSEEKTVNEIAEAIQKGVAKSIIPPSILTANASRGEYRKGVNKTDFNNLCSIMDRH
SNDRREDGSGNDKYGGPCTGKGTGENDQRFIIGGTWETKEDEVNEDHKDVLLPPRRRHMC
TSNLENLNVDSSGLSSSKVNDSFLGDVLLAAKYEGGYIKNNLSDKGDDTAICTAMKYSFA
DIGDIIRGKDLWDQNRDVKQLQENLKTIFWEHWWEKNRGKVWEAMQCGYKHGRDPTDSEK
DLAICDRKDNDYPVGNDRKEGTEYQFFRWFSEWSEDFCQKQKKQLEELEELEKGCPTDMC
TSENEKKQQMHTSIGNHNINNKAKNSLVLKIIIQMIAKYPAQHMPINIWKKKLGNIKCTS
SSIDCNCMKDESIQSPPLPESLDEQPYTVKGKCECEEKPQRPQPGPPPRPGGESQQPHND
GDGDSDNQPPAGAEEDGKETTPPPPGDTSTGPDDPFKTADSGQDTGTDGQGNNGPSAHGA
DVKPEKQDEFKHLATCPDKNQSYCNNYSIRARPGCKSKRDKYDLLENWYTITIKSKNDSY
SVQVSQRRRTLCFPKPNRKELPSYTLENFKKHLLNCAATEAKHLMDYHKDDKKISFRGNQ
IQLC
Download sequence
Identical sequences A0A0L0CW42

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]