SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0L0CYU8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0L0CYU8
Domain Number 1 Region: 470-561,595-702,764-942
Classification Level Classification E-value
Superfamily Duffy binding domain-like 4.19e-76
Family Duffy binding domain 0.00042
Further Details:      
 
Domain Number 2 Region: 26-258
Classification Level Classification E-value
Superfamily Duffy binding domain-like 1.02e-37
Family Duffy binding domain 0.0058
Further Details:      
 
Domain Number 3 Region: 926-1129
Classification Level Classification E-value
Superfamily Duffy binding domain-like 1.31e-28
Family Duffy binding domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0L0CYU8
Sequence length 1747
Comment (tr|A0A0L0CYU8|A0A0L0CYU8_PLAFA) Erythrocyte membrane protein 1 {ECO:0000313|EMBL:KNC36564.1} KW=Complete proteome; Reference proteome OX=580058 OS=Plasmodium falciparum RAJ116. GN=PFLG_01912 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MENSSTSSASDTSGTNDINNGTFYRSKYCQPCPHCGVKHNGNGWIEKKKNTDQCNIKLYK
PRDGQDGTKIEILKSGEKQKEIETKLKAFCDQTNGDTTNSVARGGGADGSGSNSNSKELY
EEWKCYQIGELQKDGQGEEDEDDPEYENDVQNAGGLCILPNPKKIKGSGKKSEPEPNDIQ
KTYNDFFYYWVAHMLKDSVHWRTKKLDKCINNSNESKACKNNNKCKTDCGCFKKWIGKKK
TEWDKIKDHFNTQEGFDKKGVNGIPVGGGLGMTADVVLEGVLELEFSNENTEQDTQNNVS
AEEAEEIKHLRDIIKKKNKEAGAGGSPGSEQKTLMDKLIEHEEGEAEKCKKTQEECERQK
QQKQQPKPSAARSAEHPDDPPADLGRSNTGPPGGPPPPPAVAAEESEEEEEEEEEEEEEK
EPEADETHTEDTEGDETETTDQEVQPPPDACSIVKTLFTTGDAKTNFKDACEQKYSIPNR
YWGWKCIPSGDKIATSRTTRDAGDSTSGKDGATGGLCIPPRRRKLYIHKVENDGINDDAS
LRDWFVKSAAVETFFLWHRYKKEKKPQAPIQLQQPLSNSDDSDPSSPQNQLQESGTIPPD
FLRLMFYTLGDYRDILVGDNTDILEAATIGSDNKTGKEIMDEIQKKIKETLESGSTEGSG
PKPGPSTGSSSGTTPSSWWKNHGQHIWHGMICALTYKENGAKGAEGKTTLKRNDEVYKKF
FGENNKVNPGTNTGTPGKPGTNGTYESKYKYTDVKLDENSGDDPLNNPKLENFVKIPTYF
RWLHEWGSDFCGTRKRMLEKIKEECMDGDGKQKKCSGDGEDCKTILSQKYNIFPDFNCPS
CSKPCGLYKRWIKIKKDEFNKQKEAYTEQRTNYTNKNKVSESNNHDKEFCTNLETKYTDA
ASFLEKLKNGPCKTDNENAEDKLDFSQPDVTFRPATNCGTCSQFKIKCENGKCKNGGETN
VGCTGNNGGTTTITANHIGNGGRSTQKLDMLVSDDSKSGSGFDGLGECKEAHIFKGIRKD
EWECGNVCGYNVCKPEKALVTHWVQNFLEDYKKITHKISHCTQNDKGFTCIKGCAEEWLK
TKKAEWGKIKDRFNEQYKNNEQDDYNMRSFLETFLVQIGAAKDKNKLEENAKKCQQDHKP
SGDSQTQTCQEHTPLPDEEDLLLEETENPVTQPNICPTPEQEPEAQDEDGCKPAAVPGNT
ITENEEDKPKADDEASGEGSSDSVETPAGESEENPEQTHVLKPEPPQEKAPAPAPHPQPP
PPLPSDNTSDILKTTIPFGIALALTSIALLFLKKKTKHPVDLFSVINIPKGDYGIPTLKS
KNRYIPYRSGTYKGKTYIYMEGDSGTDSGYTDHYSDITSSSESEYEELDINDIYVPGSPK
YKTLIEVVLEPSKSNGNTPSKGDGNTLGDMVGTTIFTDEEWNQLKHDFISQYLQSEQPKD
VPNDYTSGNSSTNTNITTMSRHNVDNNTHPTMSRDNMEEKPFITSIHDRNLYSGEEYNYD
MSTNSGNNDLYNGKNNLYSGQNNVYSGIDPTSDNRGPYSDKNDRISDNHHPYSGIDLIND
TLSGNHNVDIYDEVLKRKENELFGTNHVKQTSIHSVAKLTNSDPIHNQLNLFHTWLDRHR
DMCEKWNNKEELLDKLKEKWENETHSGNTHPSDSNKTLNTDVSIQIHMDNPKPINQFTNM
DTILEDLDKYNEPYYDVQDDIYYDVNDHDASTVDSNNMDVPSKVQIEMDVNTKLVKEKYP
IADVWDI
Download sequence
Identical sequences A0A0L0CYU8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]