SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0L0D2E4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0L0D2E4
Domain Number 1 Region: 8-104
Classification Level Classification E-value
Superfamily RNI-like 1.82e-26
Family 28-residue LRR 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0L0D2E4
Sequence length 231
Comment (tr|A0A0L0D2E4|A0A0L0D2E4_THETB) Uncharacterized protein {ECO:0000313|EMBL:KNC46467.1} KW=Complete proteome; Reference proteome OX=461836 OS=Thecamonas trahens ATCC 50062. GN=AMSG_12461 OC=Eukaryota; Apusozoa; Apusomonadidae; Thecamonas.
Sequence
MAMVVAEMCPNLTTLDLFSCSNITDAAVVAVAGGCPNLTTLNLFSCSNITDAAVVAVAGG
CPNLTTLYLEYCSNITDAAVVALAGGCPNLTTLGLDNCSNITDAATAMSIASAVLNKSDS
ANNLATKEVYNLIVGTSSIPERVADHVREAIAAGGDIGGGAGASAGTSTRVDKLEAELAD
TKAELADTKVELADVRDHVTIATGNIAALQADRANILQHVDKAIAIFQARR
Download sequence
Identical sequences A0A0L0D2E4
AMSG_12461T0 XP_013752604.1.50528

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]