SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0L0D448 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0L0D448
Domain Number 1 Region: 254-301
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 1.05e-18
Family Transcriptional factor domain 0.00064
Further Details:      
 
Domain Number 2 Region: 23-92
Classification Level Classification E-value
Superfamily Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 3.01e-17
Family Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 0.0022
Further Details:      
 
Domain Number 3 Region: 133-234
Classification Level Classification E-value
Superfamily Elongation factor TFIIS domain 2 0.000000000471
Family Elongation factor TFIIS domain 2 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0L0D448
Sequence length 302
Comment (tr|A0A0L0D448|A0A0L0D448_THETB) Transcription elongation factor S-II {ECO:0000313|EMBL:KNC46881.1} KW=Complete proteome; Reference proteome OX=461836 OS=Thecamonas trahens ATCC 50062. GN=AMSG_03312 OC=Eukaryota; Apusozoa; Apusomonadidae; Thecamonas.
Sequence
MAKSGTVATVMGINMDLKSLVSDATAKERVLDMLVQLESEPVTVEVLKKTKVGHTVNMLR
KHEVPEVRTKAKRLLASWRAMYSGSKSPATPPGQKSFKRMAPPASAKVAAAKPEAGAEAK
PASKVRADNKAVSSGTYATTGVRARDFMRKLFFEGLGKTAEGGQERTPAEVAVAIEEAMF
AAEGEDVTADYKRRGRAIAAVLRDEKNPLPLQLLQGSMSTEMFMGLSDEDLVNPDVRDTI
KAAKIQGDKDMAMAEVMAETDMFKCGKCKERKCTYYQLQTRSADEPMTVFVTCTNCGNKW
RC
Download sequence
Identical sequences A0A0L0D448
AMSG_03312T0 XP_013760154.1.50528

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]