SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0L0D5B4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0L0D5B4
Domain Number 1 Region: 53-305
Classification Level Classification E-value
Superfamily RNI-like 2.75e-30
Family Cyclin A/CDK2-associated p19, Skp2 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0L0D5B4
Sequence length 346
Comment (tr|A0A0L0D5B4|A0A0L0D5B4_THETB) F-box/LRR-repeat protein 20 {ECO:0000313|EMBL:KNC47539.1} KW=Complete proteome; Reference proteome OX=461836 OS=Thecamonas trahens ATCC 50062. GN=AMSG_02563 OC=Eukaryota; Apusozoa; Apusomonadidae; Thecamonas.
Sequence
MANHLDVGPSTLYDGDNAAFVASLDSSTATEQPAAVNVAPPSHWGAPEAAVVAAACPSLK
ALRLWSISGITAPGIATAVASWPDLISFVAYSCDSFSDDDAAELAPLAQLEELNLYGCAS
VGPRGLRALTPLPSLTTLTLEYLDRITDAALIPLLSAAPGLTSLNITRCSKLTDAVLLAL
AEHAPSLTSLHVERVHGVTDAGLVALAAGCPQLTSLCTLSHAITDAGVAALAVLPLANLN
LAYSAVSDAGLAALLSGPSLCASELVEIGLTGAKAVTDAGICALASQAPQLARFNLFRLP
CVTDAGNRVVSVVNDAPSPSRAADIAAAVAAAQPIPPDTTPASTSI
Download sequence
Identical sequences A0A0L0D5B4
XP_013759471.1.50528 AMSG_02563T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]