SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0L0D6L8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0L0D6L8
Domain Number 1 Region: 163-224
Classification Level Classification E-value
Superfamily RNI-like 0.0000412
Family Cyclin A/CDK2-associated p19, Skp2 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0L0D6L8
Sequence length 254
Comment (tr|A0A0L0D6L8|A0A0L0D6L8_THETB) Uncharacterized protein {ECO:0000313|EMBL:KNC47994.1} KW=Complete proteome; Reference proteome OX=461836 OS=Thecamonas trahens ATCC 50062. GN=AMSG_04229 OC=Eukaryota; Apusozoa; Apusomonadidae; Thecamonas.
Sequence
MDMPWRESDDGLADMETVPVVSSVNVAETMSGKAVRELGTAMRRKRKAWGDADGARPSKS
KIPVRPVLADDLASDDDDADNDDDGDGQDDGGGGGQLALDPAVLALQALDGWLAEGGADD
CDACAMPVQVMVTGRRRVALTVSAAHLDLQLARTLRRAGRVVRGLSIRGCEHVSDSAIHR
TIPELPNLVELSMSGASRVGFSSMRHFARRARSLRIVDVTRTRLEAQGVTVYLKRVYAPA
SVSVIASPSQESSS
Download sequence
Identical sequences A0A0L0D6L8
XP_013759011.1.50528 AMSG_04229T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]