SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0L0DGU3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0L0DGU3
Domain Number - Region: 3-41
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.000497
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0L0DGU3
Sequence length 141
Comment (tr|A0A0L0DGU3|A0A0L0DGU3_THETB) Uncharacterized protein {ECO:0000313|EMBL:KNC51547.1} KW=Complete proteome; Reference proteome OX=461836 OS=Thecamonas trahens ATCC 50062. GN=AMSG_07447 OC=Eukaryota; Apusozoa; Apusomonadidae; Thecamonas.
Sequence
MGEYLAEHGIDVFLNDALTLAAEVLPEKPAAFLAAYFDAVDSGTHVLGRSMEFITACAYN
AMSAGSAWREAYAGLDASMLLSGGDAFELTVRLFPDLPQEVVEAAMARSDREVEAGVTVA
SFAQLLAAELNSRVAHRLPPR
Download sequence
Identical sequences A0A0L0DGU3
XP_013755949.1.50528 AMSG_07447T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]