SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0L0DJ15 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0L0DJ15
Domain Number 1 Region: 73-141
Classification Level Classification E-value
Superfamily Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 0.00000000000115
Family Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0L0DJ15
Sequence length 144
Comment (tr|A0A0L0DJ15|A0A0L0DJ15_THETB) Uncharacterized protein {ECO:0000313|EMBL:KNC51323.1} KW=Complete proteome; Reference proteome OX=461836 OS=Thecamonas trahens ATCC 50062. GN=AMSG_07335 OC=Eukaryota; Apusozoa; Apusomonadidae; Thecamonas.
Sequence
MRMTMLGVFQRVEARLTRELTEEEKASVRTVVDAAVFAALVKSEGLDDGDDAMRGRARLS
EHGVCEVVMSIRTELLKADTTADRQIELIRALAREHITFNVLKKTKVGKTLNKLRKSSDS
RVARMAKELILVLKRLVADRSSSS
Download sequence
Identical sequences A0A0L0DJ15
AMSG_07335T0 XP_013756245.1.50528

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]