SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0L0DRV2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0L0DRV2
Domain Number 1 Region: 175-284
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 5.14e-21
Family Poly(A) polymerase, PAP, N-terminal domain 0.084
Further Details:      
 
Domain Number 2 Region: 315-485
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 1.96e-19
Family 2'-5'-oligoadenylate synthetase 1, OAS1, second domain 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0L0DRV2
Sequence length 566
Comment (tr|A0A0L0DRV2|A0A0L0DRV2_THETB) PAP/25A associated domain-containing protein {ECO:0000313|EMBL:KNC54751.1} KW=Complete proteome; Reference proteome OX=461836 OS=Thecamonas trahens ATCC 50062. GN=AMSG_01602 OC=Eukaryota; Apusozoa; Apusomonadidae; Thecamonas.
Sequence
MAGVAEPRHKQEEAEVWPHDEGCTVEKPPCGKRKKRRRRRYRVFYTHDDKYLGQVEAPSR
GSGPPAPTAGKVRSGHAVRYVARSGSGSDGASSPASETNLATTVSRRSWTATESVQLSGL
ATPADDAPPTTMPATRPGLGTAGLANTVPLPTTAPLWFAHLGGVDYGGPGRGRVRRMLRG
LSLEIESLAKMLAPTPAELELRSRLVESVRAAAGAMWPGAAVHLVGSSATSMFLPDSDLD
LVVVGVSSDGLGRLYHMADALRAVPGVVEVEVLSAATVPVVKASLAYGFGIDVVFDITTG
VETVARMGPLLAAYPLVRPLALVLKHMLRTHRLNSAYSGGLCSHGLVLLLISMLQFMGQV
SPKHVFHSCTPPSPLPAVVTPPTTAASLPDDQALGFCFIHFLRLYGTEFVYDYRISVADG
GVLSLCAEPDGPSAAEADGPRIQLRLEDPVSGGDVGAGAFMYDVVRSLFQAKYYAMAHAV
RSSSLTSLLALVIDPSEFAVYARWRHSVLYPTSPPDAAPPVSPMADHTAATTRPRSKSSR
SRGGRRHRNRNRNRAQRPSQDVDQGI
Download sequence
Identical sequences A0A0L0DRV2
AMSG_01602T0 XP_013761651.1.50528

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]