SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0L0S276 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0L0S276
Domain Number 1 Region: 26-68
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00000000392
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0026
Further Details:      
 
Weak hits

Sequence:  A0A0L0S276
Domain Number - Region: 77-195
Classification Level Classification E-value
Superfamily EF-hand 0.00951
Family Calmodulin-like 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0L0S276
Sequence length 219
Comment (tr|A0A0L0S276|A0A0L0S276_ALLMA) Uncharacterized protein {ECO:0000313|EMBL:KNE56658.1} KW=Complete proteome; Reference proteome OX=578462 OS=Allomyces macrogynus ATCC 38327. GN=AMAG_02444 OC=Blastocladiales; Blastocladiaceae; Allomyces.
Sequence
MAPPVASDVPAPAPAAGDDGPIYSREQIVIPPEFPTILKNYSKFIIKNQPADIVAVSVEY
FSKLHKHQQLGRKVHTNGVAREQLETLYSMFNLRGSTNVPKDSLIKIAVDALIPPTTVDE
LLKVGSWDGLDSVNWVEFWALCCAVAAGTIQATALLAVDILTNNGQVPSDILVKLVRYLA
KVDGAIDSDKLALCTNVLEGDGAWTPENKAVDAIKKYLV
Download sequence
Identical sequences A0A0L0S276
AMAG_02444T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]