SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0L0UUB2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0L0UUB2
Domain Number 1 Region: 225-318
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000000107
Family Thioltransferase 0.065
Further Details:      
 
Domain Number 2 Region: 428-543
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000827
Family UBX domain 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0L0UUB2
Sequence length 597
Comment (tr|A0A0L0UUB2|A0A0L0UUB2_9BASI) Uncharacterized protein {ECO:0000313|EMBL:KNE90637.1} KW=Complete proteome; Reference proteome OX=1165861 OS=Puccinia striiformis f. sp. tritici PST-78. GN=PSTG_15900 OC=Pucciniomycetes; Pucciniales; Pucciniaceae; Puccinia.
Sequence
MHSETQEDEAISSYLSFTNTSDIQAARNALRLANGNLETAVEAYLDSTSTLSSSNNNHNN
QYEQLSLDDSYQSDRTHLLPSDESPDSNYNATSPNHLLPGGSARSSNRPTRAFEPANRPR
RSSSKLFSFFFRLWIGPFRLIAIPVSFVADLGLTVFSLIGRLLGLRLPTMSFHWPRPSTF
NWGGGATIATDPRTAAERWVRELEEELHARSSYTTTAPGDDPSIPRLPEFLLLGYDDAVQ
KAKDELKVLMVVLVSEEHDDVHQFKRDTLMDEELLNLLRTKDILVWGGDVKGRDASFAAH
VLDATTYPFVAFISLQAKRPSSTVTTITSSVNRSSSNVMSVCTRLEGSPLNPTSSRSICA
TINSVVIPRTNGYLSRLRTEKARRESDRRLREEQDRAYAEAGRLDRERVMKKKAELEAER
KRLEEIKSKELERERARQSKLEEAEQKRRWRYWARQENKSFEPPTTGGVTIGFRLGDGRR
VVRKFKADDTLESLYLFVELESTSSLTAQDHHQNYTPPPRPSPDYRHSYSFKLSTAMPRR
ILPLPESSSPSKLSTTSGHQQTSTIAQFGGLDGANVNVEGNVVEQNSDDDDDDDEED
Download sequence
Identical sequences A0A0L0UUB2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]