SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0L1I3G2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0L1I3G2
Domain Number 1 Region: 1-64,96-184
Classification Level Classification E-value
Superfamily Duffy binding domain-like 3.27e-19
Family Duffy binding domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0L1I3G2
Sequence length 535
Comment (tr|A0A0L1I3G2|A0A0L1I3G2_PLAFA) Erythrocyte membrane protein 1 {ECO:0000313|EMBL:KNG73962.1} KW=Complete proteome; Reference proteome OX=580059 OS=Plasmodium falciparum IGH-CR14. GN=PFMG_00135 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MFHTYSDFRDLCLGKDIGNDVGNGKTNIDRIFSKNNQTIEPEIWWKTIEKDIGEAMFCVL
SYDTTKKKKKIQESVRNELTKNITYKYKNVIFNGNITTLTDFSTKSKFLQWLMEWARKYC
SEKIKKNVKCQMSLNEYKNWFNNSHLEWEKLKDEKKLYKQQSSYKYTEETAEDYVKKRCL
ECNCNYEDLKTVHEIKHNKIILKTKDCVENTFWTGFMSPLELEGFGVTIDKSKAEEDREN
HVPPVRPHPPSGPSTVDGEQQPQDPSVVPRAGADHESSGSPGSQNNYSSFSSLYNMLTYG
IPIRIGFLLDSKNIYKKPKLRPTKLFRVIDIPQNDYNMPTARSPNREYEDIGINNIYSYK
SPKYKTLIEVVLKPSEQTYDMKVTHAYYKDDSNKLTDEEWNQLKHEFIPDYLEDLSNTQP
NTLYFDNYDEKPFITKIQDRFLDSSLEEVTYNFDWNIPKHNKSQNNVSQNDVYTGIDLIN
DKLNIDEHVDIYVEILNRKKNELYGTKHIKENTDSNIFANKNIFCSNNKPNRFVP
Download sequence
Identical sequences A0A0L1I3G2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]