SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0L1I457 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0L1I457
Domain Number 1 Region: 68-475
Classification Level Classification E-value
Superfamily Duffy binding domain-like 2.88e-78
Family Duffy binding domain 0.0001
Further Details:      
 
Domain Number 2 Region: 792-1156,1206-1223
Classification Level Classification E-value
Superfamily Duffy binding domain-like 4.58e-75
Family Duffy binding domain 0.00011
Further Details:      
 
Domain Number 3 Region: 1272-1604
Classification Level Classification E-value
Superfamily Duffy binding domain-like 5.1e-72
Family Duffy binding domain 0.0000954
Further Details:      
 
Domain Number 4 Region: 2049-2395
Classification Level Classification E-value
Superfamily Duffy binding domain-like 9.68e-70
Family Duffy binding domain 0.0000498
Further Details:      
 
Domain Number 5 Region: 2526-2880
Classification Level Classification E-value
Superfamily Duffy binding domain-like 7.59e-64
Family Duffy binding domain 0.0000916
Further Details:      
 
Domain Number 6 Region: 1652-1983
Classification Level Classification E-value
Superfamily Duffy binding domain-like 1.96e-55
Family Duffy binding domain 0.00018
Further Details:      
 
Domain Number 7 Region: 2887-3189
Classification Level Classification E-value
Superfamily Duffy binding domain-like 7.72e-52
Family Duffy binding domain 0.0002
Further Details:      
 
Domain Number 8 Region: 468-677
Classification Level Classification E-value
Superfamily Duffy binding domain-like 4.58e-32
Family Duffy binding domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0L1I457
Sequence length 3642
Comment (tr|A0A0L1I457|A0A0L1I457_PLAFA) FCR3 CSA ligand {ECO:0000313|EMBL:KNG74262.1} KW=Complete proteome; Reference proteome OX=580059 OS=Plasmodium falciparum IGH-CR14. GN=PFMG_00471 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MGNTESSLEGEARSPSIIESENSPRNVLERYAKNIRQASKDENEHVDSLKGDLTKAEFRG
GPSTPVNKHNYYYSYPCNLDHKEHTNLRYDDVNLRHPCHGREQKRFDEDEESECGNKIRN
YKRENDAIACAPPRRRHMCDKNLEALNDINTQNIHDLLGNVLVTAKYEGESIVNNHPHKG
TSDVCTALARSFADIGDIIRGIDMFKPNVHDKVEKGLREVFKKIHDEMEGEVKNYYNPDG
SGNYYKLREAWWDVNRNKVWEAITCGALPKSAYFMQSEDNKQLFSYLKCGHNKKNDPPTN
LDYVPQYLRWFDEWGEEFCRKRNIKLKKVKDSCRNDKERLYCSHDGYDCTRTIWKKGSLH
LDKKCTDCSTKCKVFEVWLGNQQEAFKKQKEKYEKEMNGKTSEHDSTNNNINNKYYKDFY
KLLEKNDYKTVHGFINLLNKGRYCKETLPGEEVMDFTKTGDRETFYRSQYCQVCPDCGVK
YDGTQCTHKSDNDSECVNNEDYKLPWGVKPTNITVLYSGNDQGDITQKLEDFCNSSTNYK
DKNNQKWECYYKDENINRCRLEQNTEINKNNPKITSFHNFFELWVTYLLRDTIKWNDKLK
TCINNTTTHCIDECNRNCLCFDRWVKQKEEEWNSIKKLFTKKKNMQQSYYSNINNLFEGY
FFKVMDKLDKNEAKWKELMENIKKKKNEFSNLKNNRDYLENAIELLLDHLKETSTICKDN
NTNEACETSHNATTNPCVKPRGGTQRTKNIKEIAQYFKRSAYEEARNRDLHKLKGKAHEG
LYKRGGKGKDFKDNLCRIMIKHSNRNIGFSNGPCDGKGTGDDIQTRFVVGTEWEVDPEHM
RKDHEDVIIPPRRRHICTSNLEHLQTDDHPLNGNIVADLVNNSFLGDVLLSAKYEAKKII
QMYKEKNNLKGPKEVTDPKHQTTICRAIRYSFADIGDIIRGRDLWERNGDMVKLQGHLET
VFGNIHKSLKGKGNDKYNDDAPKYLKLREDWWEANRAKVWEAMKCDIKYLKDKSRPQSTQ
SSYCGYSDHTPLDDYIPQKLRWMTEWAEWYCKVQKKEYDKLKEKCKECKDKYNGQGCTKE
SGTCCTKCTDACNEYNDIIGLWKEQWNIISDKYKELHEQAQMSVSNSGIEASSAAKNHID
RNVIEFLSELYQQDGGKSNKSGTSDQSTVIGTNTRYENVGAYLHDTGNFDDCQLQNEFCD
EKSDGKDKEKYAFRDKPQDHDGACGCKGRPKQTVVQIKTKEKAQEKDTECKTVNDILKEN
DGQKQVEDCHPKKNSNGYPDWKCGNINLVEDPRVCMPPRRQKLCVHFLANDNEIKKLQSQ
VNLKEAFIKSAAAETFFSWYYYKSKDGEGNELDKELKEGKIPPAFLRSMFYTFGDYRDFL
FGTDISKGHGEGSKLKEQIDSLFKNGDQKPPNGKTRQEWWTEYSHEIWEAMLCALVKIGA
KKDYLTENYGYNNVKFSDKSNTLEEFAKRPQFLRWLTEWYDDYCYTRQKYLKDVKEKCKS
NDQLKCDKECNKKCEDYEKYMKKKKEEWIPQDKYYKDERDKKRFDRQHIGVMVTDYTGTN
ATDYLNRKFTASCGDKPGSASVVQRNIQLLEKQAYYDADKHCGCTKFIENDGKYTNISSK
DDCKGLVKEANAGAIKWQNKGPKNYNNLKELTEEVLFPSRRLRICFHALDGNYTDPEVND
ENGLRKRLMEVAATEGYNLGQYYKEKNEKEKETKAEADKYSYDVQPCSAMKYSFYDLRDI
IMGYDNLEEDKQDIEKNMKKIFSKNRTSVVEGSDSSTGNPGSSVRTEFWNKNKECVWNAM
ICGYKKGHGDDNLPKECEEVPDDQPIGSNRGQGTAYQFLRWFTEWGEDFCKKVSKELKTL
QKACPQKVCKDADASKKKVCSDACANYKIFIKQWREEYKKQSKKYTEDKTAKKYDNHSVA
RDAKDAREYLDKQLKKFCENKSGDCEYKCMKDVSTKSLTDVNSQNMPASLDDEPKEVEGK
CNCQVPPGPPRARLETPSPRASLTAKATASKKEVKTAPPTKQPKKVENLTTEMRAQTRTR
RAAQQTRKRTSTATTTESDVGTMVKAILSNKPDSRGGIEGCNPKTYGQYPKWGCIVGKSK
ENENGICMPPRRKKLCINNIQYLNYETENKRDNDIKEAFIKCAAIETQFLWLKYIIENPA
AENELQNGTIPDEFKRIMYYTYGDYKDMFFGTDISNDKKIITVTNSVTTILNENNKKKQD
KKKDEELRKIFWEKNKKFIWEGMIYGLTYHLTDENEKEKIRDNYQYNDMTKLTPSLEEFV
KRPQFLRWFTEWAEEFCNKRKEQLKKLEAGCKEYECNGSDDGKTQECAEACVTYQKFIKK
WKTEYERQREKFKKDKDGKKYKDYPSTERDIEKATCAHEYLNMKLKELCGNKDCSCMQKP
SSQLPKTTQQSQSSDANDMPESLDYVPEEFNKCECPELSKKGSMIHTKKITEPKIPMNCV
EKAAYYLSKEAENNMDITLKEKFIPIESTKEKESKNSWTNNNPCDPKKPYAPDKYIGRRN
PCENREENRFKVDYEWKCYKNSKFYQEKKRVCVPPRREHMCLRNLDEIKIERLKDSNYLL
KMVRRTARNEGIDIIKNFNSENGCAMNPICDTMKYSFADLGDIVRGTDMLRIGGYLPPVE
IKLYKVFEYIYGKWRNKNKGRNKYNDVQTFRSAWWDANRKDIWKAMTCKAPEDAKLFRKG
RMDGFERITLIQDKCGHKDDPPVDDYIPQRFRWMTEWSEYYCKALIDELEKFKKSCDHCK
TTDRCKNDYDKNKCEECKTRCQEYKNFVLKWKSLFDIQSNKYKELYEQPIDTKISAYDHV
QNFVQKLKSFKSECSVESFSEYLHETSKCLNYKFNENDGSNIRSYAFEETPKSYKEACSC
TLPSKNPLDNCPTDQNKDVCKELQNFTFCSKNDYDNNLDNWNAYLVLNSSDDNKGVLIPP
RRRHLCTRPITAYNYRKGDKEILKKKLLTSAFSQGQLLGQKYKSEEELCFEAMKYSYADY
SDIIKGTDMMDTSLSEKIKKIFETSNEATENRKTWWEKNRSHVWHAMLCGYISKNKNENV
NPEWCNVPTEDGTDQFLRWLMEWAMQACKEKKHLRDSLKTKCRCSNEDNFEASELLRQPG
CQNDIRKYISLNILIKNSMENLNIKYKQLKDQSSGNIDNKPSEENVQLYIKSKYSECDLE
LNDINEIVTGTKNNENNELKEVLKKLHPGSCFDENKAHENHVVVQNKKKEAQAVHPNVFY
YFPVNLGSFYQASLFSTHRVAQYDPKNDILKSSISVVIVSALGLIALLFMKKKFKSSVDL
LRVIDIPKGDYGMPTLKSKNRYIPYRSGPYKGKTYIYMEGDTSGDEDKYIWDLSSSDITS
SESEYEELDINDIYVPGSPKYKTLIEVVLEPSKRDISSDDIPSDYTPSNDTPRTNRFIDD
EWNELKHDFVSQYLPNTEPNNNYRSADIPMNTEPNTLYFDNPEEKPFIISIHDRDLYTGK
EISYNINMSTNTNNDIPMNARNDSYRDLFHTWFDRHRDMCKQWINKEDILNKLNEGWKKD
NDGGNVPIDNRTLNTDVSIQIDMDHGKPKKEFTNMDTNVDTPTMDSILYDLERHNEPFYD
IYEDDVYYDVNDDNKTSAHHNNLDVSSKVQIEMDVNTKLAKE
Download sequence
Identical sequences A0A0L1I457

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]