SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0L1I4I2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0L1I4I2
Domain Number 1 Region: 57-271,301-488
Classification Level Classification E-value
Superfamily Duffy binding domain-like 4.84e-85
Family Duffy binding domain 0.00016
Further Details:      
 
Domain Number 2 Region: 861-878,911-937,967-999,1042-1135,1199-1378
Classification Level Classification E-value
Superfamily Duffy binding domain-like 3.79e-75
Family Duffy binding domain 0.0009
Further Details:      
 
Domain Number 3 Region: 1752-2105
Classification Level Classification E-value
Superfamily Duffy binding domain-like 4.45e-66
Family Duffy binding domain 0.0000601
Further Details:      
 
Domain Number 4 Region: 2103-2429
Classification Level Classification E-value
Superfamily Duffy binding domain-like 3.27e-62
Family Duffy binding domain 0.0000582
Further Details:      
 
Domain Number 5 Region: 515-707,746-766
Classification Level Classification E-value
Superfamily Duffy binding domain-like 6.41e-34
Family Duffy binding domain 0.0078
Further Details:      
 
Domain Number 6 Region: 1415-1587,1617-1636
Classification Level Classification E-value
Superfamily Duffy binding domain-like 1.06e-26
Family Duffy binding domain 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0L1I4I2
Sequence length 2932
Comment (tr|A0A0L1I4I2|A0A0L1I4I2_PLAFA) Erythrocyte membrane protein 1 {ECO:0000313|EMBL:KNG74539.1} KW=Complete proteome; Reference proteome OX=580059 OS=Plasmodium falciparum IGH-CR14. GN=PFMG_00714 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MAPGSTGTQEDRIDDTTAKRLLDSIGKIVHDQVKNGVAEKYKGELEGKLTDSSILDGELA
GITDTCNLVKEYYKHLNGGGSGERNPCKGLSVINVERFSDTLGGQCTDSKIEGNKNNCGA
CAPFRRLHLCHHNLESIDTTSMTHKLLLEVCMAAKYEGNSIDTHYPQHKNTNNDSASQLC
TVLARSFADIGDIVRGKDLFYGNPQEKEQREKLDEKLKTIFGKIHEGLKNEELKTRYNGD
KENYYKLREDWWEANRETVWEAITCDVKSGNNYFRHTCGDEKTGTLTPNKCRCPKTSGAN
VDPPTYFDYVPQYLRWFEEWAEDFCRLRKRKLEDAKNKCRGKNGTERYCDLNRYDCTQTA
SGEKKFVEGKDCIGCHFSCSHFVKWIDNQKLEFLKQKKKYKTEISVGGGRKKRAAGGGSD
HKGYEKIFYEKLKDSGYRSVESFLKKLNDEAICKKHPKVEDEKADRADFTKKDYGKTFDH
TTYCQACPWCGAHKKDEKWEPKTQICGKEKNYHSQNITNIPILTPEKGKLGIVKKYNKFC
NGNGGNGAPGTANVGARGGKGEKSANGKKDDQIETWQCYYDDSINDGEQNDNCVEGEWKD
FIEGKKVKPYNVFFWDWVHDMLHDSVEWKTELSKCINNNTNGNTCRNNNKCKTDCGCFQK
WVKQKEQEWTQIKDHFGKQKNILPVGDLAAMMTPDIVLKYVLQDGNLLQNIKDTHADAKD
IERIEALLDEEKQKSKAEAGAGGVTEQKSIIVELLQHEKDEANKCKKNQEDCNRQLEEQR
SRARSASEDDSPLPPADIEPDSEEDDEEEEAEDGSKEEEKEEKQEVDTDKKGEEKEPKEE
GKSACEIVSDLFKVTNKFSDACGLKYGPKAPTSWKCVTPSGSDTGEATGEGSGSEAKRKG
RSAGVPDGATTGSICVPPRRRKLYVTPLTKLTGGDGNTQSVGGDKDTQASQAQPEGAASQ
SPPASTSSTASPSPKGDALLTAFVESAAIETFFLWDRYKKEWEQRNKPQNGLLSAAQAAQ
PQLQVPGVTGDSNDPQNKLKSGTIPPDFLRQMFYTLGDYRDICVGNDVPNGGSDKEMADR
EKTIKDAISSYFSKSENQATGAENPGQTTKPEEWWNDTLGPAVWNGMICALTYKEIEVKN
PDGKNTYKIEQIQDANGTHLFDTLKGKYSDYEKVKLDENSDTEAKTTGGANPLTASTSGE
NTTLNNPKLSDFVKRPPYFRYLEEWGETFCRKRKRMLEKIKEECRSEKTGHEYCSGDGHD
CTKDGELKHKNMFDDLVCRDCHEQCRKYRKWIDIKFEEYHNQKNTYGKEHKKLKDNSKND
GDTKKFCQQIQQHTTAANFLESLNHCKPGDDDKDKNDEINFKQPLETFRHSKYCEMCPSY
EVKCNGSNRRGKNPCTAVNGNGETWAKVFERISGNGEKTTKIDVHMIDRRGPFIEKYLEN
SKPSQNSNDLFKTSKLFKGIRKQNWTCKFNKEKKMDVCKLNKFKENIDLNEYTTFKVLLH
YWLEDFIQGYYLLKKKKKIDLCTENGENTCDANSKNDCACVEKWIKQKTTEWEQIKDHYN
KKEYGNGHDMAYKVTSYFEKYANDLIKGIDEYKRRKKIDEYEDCNGQNNCTSEDKKRKKD
MVTLLLSRLQNEINKCPSSTSGNEQCTTPPSNLDDDDTPDEPLDDYYIQQPKICPPPMTC
VEEIAKKLREDAERAIDKIKDKLKGNGTTFNGGCKMIKKNDTPGNGQESCDFKTTYENSV
NNINNKCKDNRMERFKIGETWKCVKIYKIGKDICIPPRREHMCLDDLNTLGRSTVNDSTE
LLKKIQKVAKSEGDDIIKNLLPQNSCNENVICDAMKYSFADLGDIIRGRDLLNKNNKQKG
IQKKIENTFENIYNKMGNDKNKYEKDRPKYLQLRSDWWDANRKAIWNAMTCNAPDAAKFL
KKDTNDSSGTSSSKGIFSNDPKCGHQKDPPDYDYIPQPFRWMQEWSETFCKLLNEEIQKF
ETECKDCKSNGLSCQDDKNGKKCEKCKKQCKNYQELIDKWKLEFDKYKETYNELYNDKAK
ISSEEYFKKFLEKLKAECKEENTADKYLDKASHCKKYKFSNSENKNHNNYAFKHTPKDFE
QACKCEAPDPLDQCPNNERNKGACKKLSVENECKNKNLINDDNWSAREVKDSTGNNEGVL
VPPRRRHLCLRNITSNTKSINNKKIFKNELLKSAYSEGYYLWDKYKHDSTTLLDVMRYSF
YDYGDIVKGTDMMDNYLLDQLKNKLNELLKENNDNEILKHRENWWEENKTHVWHAMICGY
QERNGYKKINASWCTLPTEDNNSYQFLRWFREWTESFCFHRKKLYNIMVSKCNEAECDKT
TGRISLPQCANACAQYRSYVWTKKNEYFSQKQKYDKDFKASNNKNDAPYYFRSTFFSKNY
DCLFDNFNGDNKWKNPYESFNESTYKDKCDCQKTVPPPHVPPPPPPKSDELPAPADQPLD
PTILQTTIPFGVALALGSIAFLFLKKKTHAPLDLFSVINIPKSDYDIPTKLSPNRYIPYT
SGKYRGKRYIYLEGDSGTDSGYTDHYSDITSSESEYEEMDINDIYAPRAPKYKTLIEVVL
EPSGKNTTASGKNTPSDTQNDIPTSDTPPPITDDEWNTLKHDFISNMLQNEPNTEPNDYS
SGDIPFNTQPNTLYFDNNQEKPFITSIHDRDLYTGEEYNYDMSTNSGNNDLYNGKNNLYS
GENNVYGGIDPTSDNRGPYSDKNDRISDNHHPYSGIDLINDTLSGNQHIDIYDELLKRKE
NELFGTNHTKKNTSTNSVAKNTNSDPIDNQLDLFHKWLDRHRDMCEKWENHHERLAKLKE
EWENETHSGNIHTSDSNKTLNSDVSIQIHMDNPKPINQFNNMDTILEDLDKPFNEPYYYD
MYDDDIYYDVHDHDTSTVDSNNMDVPSKVQIEMDINTKLVKEKYPIADVWDI
Download sequence
Identical sequences A0A0L1I4I2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]